KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101136722
Entry
101136722         CDS       T02442                                 

Gene name
MAP3K1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04120  Ubiquitin mediated proteolysis
ggo04530  Tight junction
ggo04622  RIG-I-like receptor signaling pathway
ggo04722  Neurotrophin signaling pathway
ggo04912  GnRH signaling pathway
ggo04935  Growth hormone synthesis, secretion and action
ggo05161  Hepatitis B
ggo05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101136722 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101136722 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101136722 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101136722 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101136722 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    101136722 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101136722 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101136722 (MAP3K1)
   05161 Hepatitis B
    101136722 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101136722 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ggo04121]
    101136722 (MAP3K1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101136722 (MAP3K1)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: STE group
  STE11 family
   101136722 (MAP3K1)
Ubiquitin system [BR:ggo04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101136722 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 PHD Phostensin_N APH FANCL_C zf-ANAPC11
Other DBs
NCBI-GeneID: 101136722
NCBI-ProteinID: XP_030859362
Ensembl: ENSGGOG00000014603
LinkDB
Position
17
AA seq 1508 aa
MAAAAGNRASSSGFPGAGAASPEAGGGGGALKASSAPAAAAGLLREAGSGGRERAEWRRR
QLRKVRSVELDQLPEQPLFLAASPPSSSTSPSPEPADAAGSGTGFQPVAVPPPHGAASRG
GAHLAESVAATDSGASSPAAAEPGEKRAPAAEPSPAAAPAGREMENKETLKGLHKMDDRP
EERMIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPVKGDGSEMNHLAAESPGEAQASA
ASPASKGRRSPSPGNSPSGRTVKSESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYS
PEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCARGTFCIHLLF
VMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHT
LSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECR
RNREPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTIQQQPLAGSQRRNQESNF
NLTHYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLAN
GESTGNSGGSSGSSPSGGATSGSSQTSISGDVVEACCSVLSMVCADPVYKVYVAALKTLR
AMLVYTPCHSLAERIKLQRLLQPVVDTILVKCADANSRTSQLSISTLLELCKGQAGELAI
GREILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPAEFYPHIVST
DVSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTTVPHVFSKLLE
MLSVSSSTHFTRMRRRLMAIADEVEIAEAIQLGVEDTLDGQQDSFLQASIPNNYLETTEN
STPECTIHLEKTGKGLCATKLSASSEDISERLASISVGPSSSTTTEQPKPMVQTKGRPHS
QCLNSSPLSHHSQLMFPALSTPSSSTPSVPAGTATDVSKHRLQGFIPCRIPSASPQTQRK
FSLQFHRNCPENKDSDKLSPVFTQSRPLPSSNIHRPKPSRPTPGNTSKQGDPSKNSMTLD
LNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSD
TTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQDALPI
VPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQAQDVG
TGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYNLFIE
WMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRL
RIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMAC
AKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLK
HPVFRTTW
NT seq 4527 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcgtcgggattcccgggcgccggggctgcg
agccctgaggcgggcggcggcggaggagccctcaaggcgagcagcgcgcccgcggctgcc
gcgggactgctgcgggaggcgggcagcgggggccgcgagcgggcggagtggcggcggcgg
cagctgcgcaaagtgcggagtgtggagctggaccagctgcctgagcagccgctcttcctt
gccgcctcaccgccgtcctcctcgacttccccgtcgccggagcccgcggacgcagcgggg
agtgggaccggcttccagcctgtggcggtgccgccgccccacggagccgcgagccgcggc
ggcgcccaccttgccgagtcggtggcggcgacggacagcggcgcctcgagtcccgcagcg
gccgagcccggggagaagcgggcgcccgccgccgagccgtctcctgcagcggcccccgcc
ggtcgtgagatggagaataaagaaactctcaaagggttgcacaagatggatgatcgtcca
gaggaacgaatgatcagggagaaactgaaggcaacctgtatgccagcctggaagcacgaa
tggttggaaaggagaaataggcgagggcctgtggtggtaaaaccaatcccagttaaagga
gatggatctgaaatgaatcacttagcagctgagtctccaggagaggcccaggcaagtgcg
gcttcaccagcttccaaaggccgacgcagtccttctcctggcaactccccatcaggtcgc
acagtgaaatcagaatctccaggagtaaggagaaaaagagtttccccagtgccttttcag
agtggcagaatcacaccaccccgaagagccccttcaccagatggcttctcaccatatagc
cctgaggaaacaaaccgccgtgttaacaaagtgatgcgggccagactatacttactgcag
cagatagggcctaactctttcctgattggaggagacagcccagacaataaataccgggtg
tttattgggcctcagaactgcagctgtgcacgtggaacattctgtattcatctgctattt
gtgatgctccgggtgtttcaactagaaccttcagacccaatgttatggagaaaaacttta
aagaattttgaggttgagagtttgttccagaaatatcacagtaggcgtagctcaaggatc
aaagctccatctcgtaacaccatccagaagtttgtttcacgcatgtcaaattctcataca
ttgtcatcatctagtacttctacatctagttcagaaaacagcataaaggatgaagaggaa
cagatgtgtcctatttgcttgttgggcatgcttgatgaagaaagtcttacagtttgtgaa
gacggctgcaggaacaagctgcaccaccactgcatgtcaatttgggcagaagagtgtaga
agaaatagagaacctttaatatgtcccctttgtagatctaagtggagatctcatgatttc
tacagccacgagttgtccagtcctgtggattccccttcttccctcagagctgcacagcag
caaaccatacagcagcagcctttggctggatcacaaagaaggaatcaagagagcaatttt
aaccttactcattatggaactcagcaaatccctcctgcttacaaagatttagctgagcca
tggattcaggtgtttggaatggaactcgttggctgcttattttctagaaactggaatgtg
agagagatggccctcaggcgtctttcccatgatgtcagtggggccctgctgttggcaaat
ggggagagcactggaaattctgggggcagcagtggaagcagcccgagtgggggagccacc
agtgggtcttcccagaccagtatctcaggagatgtggtggaggcatgctgcagcgttctg
tcaatggtctgtgctgaccctgtctacaaagtgtacgttgctgctttaaaaacattgaga
gccatgctggtatatactccttgccacagtttagcggaaagaatcaaacttcagagactt
ctgcagccagttgtagacaccatcctagtcaaatgtgcagatgccaatagccgcacaagt
cagctgtccatatcaacactgttggaactgtgcaaaggccaagcaggagagttggcaatt
ggcagagaaatactaaaagctggatccattggtattggtggtgttgattatgtcttaaat
tgtattcttggaaaccaaactgaatcaaacaattggcaagaacttcttggccgcctttgt
cttatagatagactgttgttggaatttcctgctgaattttatcctcatattgtcagtact
gatgtttcacaagctgagcctgttgaaatcaggtataagaagctgctgtccctcttaacc
tttgctttgcagtccattgataattcccactcaatggttggcaaactttccagaaggatc
tacttgagttctgcaagaatggttactacagtaccccatgtgttttcaaaactgttagaa
atgctgagtgtttccagttccactcacttcaccaggatgcgtcgccgtttgatggctatt
gcagatgaggtggaaattgccgaagccatccagttgggcgtagaagacactttggatggt
caacaggacagcttcttgcaggcatctattcccaacaactatctggaaaccacagagaac
agtacccctgagtgcacaatccatttagagaaaactggaaaaggattatgtgctacaaaa
ttgagtgccagttcagaggacatttctgagagactggccagcatttcagtaggaccttct
agttcaacaacaacagagcaaccaaagccaatggttcaaacaaaaggcagaccccacagt
cagtgtttgaactcctctcctttatctcatcattcccaattaatgtttccagccttgtca
accccttcttcttcgaccccatctgtaccagctggcactgcaacagatgtctctaagcat
agacttcagggattcattccctgcagaataccttctgcatctcctcaaacacagcgcaag
ttttctctacaattccacagaaactgtcctgaaaacaaagactcagataaactttcccca
gtctttactcagtcaagacccttgccctccagtaacatacacaggccaaagccatctcga
cctaccccaggtaatacaagtaaacagggagatccctcaaaaaatagcatgacacttgat
ctgaacagtagttccaaatgtgatgacagctttggctgtagcagcaatagtagtaatgct
gttatacccagtgacgagacagtgttcaccccagtggaggagaaatgcagattagatgtc
aatacagagctcaactccagtattgaggaccttcttgaagcatctatgccttcaagtgat
acaacagtaacttttaagtcagaagttgctgtcctgtctcctgaaaaggctgaaaatgat
gatacctacaaagatgatgtgaatcataatcaaaagtgcaaagagaagatggaagctgaa
gaagaagaagctttagcaattgccatggcaatgtcagcgtctcaggatgccctccccata
gttcctcagctgcaggttgaaaatggagaagatatcatcattattcaacaggatacacca
gagactctaccaggacataccaaagcaaaacaaccgtatagagaagacactgaatggctg
aaaggtcaacagataggccttggagcattttcttcttgttatcaggctcaagatgtggga
actggaactttaatggctgttaaacaggtgacttatgtcagaaacacatcttctgagcaa
gaagaagtagtagaagcactaagagaagagataagaatgatgagccatctgaatcatcca
aacatcattaggatgttgggagccacgtgtgagaagagcaattacaatctcttcattgaa
tggatggcagggggatcggtggctcatttgctgagtaaatatggagccttcaaagaatca
gtagttattaactacactgaacagttactccgtggcctttcgtatctccatgaaaaccaa
atcattcacagagatgtcaaaggtgccaatttgctaattgacagcactggtcagagacta
agaattgcagattttggagctgcagccaggttggcatcaaaaggaactggtgcaggagag
tttcagggacaattactggggacaattgcatttatggcacctgaggtactaagaggtcaa
cagtatggaaggagctgtgatgtatggagtgttggctgtgctattatagaaatggcttgt
gcaaaaccaccatggaatgcagaaaaacactccaatcatcttgctttgatatttaagatt
gctagtgcaactactgctccatcgatcccttcacatttgtctcctggtttacgagatgtg
gctcttcgttgtttagaacttcaacctcaggacagacctccatcaagagagctactgaag
catccagtctttcgtactacatggtag

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101148044
Entry
101148044         CDS       T02442                                 

Gene name
MAP3K3
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3 isoform X3
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04722  Neurotrophin signaling pathway
ggo04912  GnRH signaling pathway
ggo05166  Human T-cell leukemia virus 1 infection
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101148044 (MAP3K3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101148044 (MAP3K3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101148044 (MAP3K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101148044 (MAP3K3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101148044 (MAP3K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101148044 (MAP3K3)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101148044 (MAP3K3)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: STE group
  STE11 family
   101148044 (MAP3K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 101148044
NCBI-ProteinID: XP_004041202
Ensembl: ENSGGOG00000004086
UniProt: G3QN99
LinkDB
Position
5
AA seq 626 aa
MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAF
SRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILL
LSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPG
YVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSF
RKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRR
HQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPI
NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ
HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYL
HSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVIS
GEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFL
RRIFVEARQRPSAEELLTHHFAQLMY
NT seq 1881 nt   +upstreamnt  +downstreamnt
atggacgaacaggaggcattgaactcaatcatgaacgatctggtggccctccagatgaac
cgacgtcaccggatgcctggatatgagaccatgaagaacaaagacacaggtcactcaaat
aggcagagtgacgtcagaatcaagttcgagcacaacggggagaggcgaattatagcgttc
agccggcctgtgaaatatgaagatgtggagcacaaggtgacaacagtatttggacaacct
cttgatctacattacatgaacaatgagctctccatcctgctgaaaaaccaagatgatctt
gataaagcaattgacattttggatagaagctcaagcatgaaaagccttaggatattgctg
ttgtcccaggacagaaaccataacagttcctctcctcactctggggtgtccagacaggtg
cggatcaaggcttcccagtccgcaggggatataaatactatctaccagccccccgagccc
agaagcaggcacctctctgtcagctcccagaaccctggccgaagctcacctccccctggc
tatgttcctgagcggcagcagcacattgcccggcaggggtcctacaccagcatcaacagt
gagggggagttcatcccagagaccagcgagcagtgcatgctggatcccctgagcagtgca
gaaaattccttgtctggaagctgccaatccttggacaggtcagcagacagcccatccttc
cggaaatcacgaatgtcccgtgcccagagcttccctgacaacagacaggaatactcagat
cgggaaactcagctttatgacaaaggggtcaaaggtggaacctacccccggcgctaccac
gtgtctgtgcaccacaaggactacagtgatggcagaagaacatttccccgaatacggcgt
catcaaggcaacttgttcaccctggtgccctccagccgctccctgagcacaaatggcgag
aacatgggtctggctgtgcaatacctggacccccgtggtcgcctgcggagtgcggacagc
gagaatgccctctctgtgcaggagaggaatgtgccaaccaagtctcccagtgcccccatc
aattggcgccggggaaagcttctgggccagggtgccttcggcagggtctatttgtgctat
gacgtggacacgggacgtgaacttgcttccaagcaggtccaatttgatccagacagtcct
gagacaagcaaggaggtgagtgctctggagtgcgagatccagttgctaaagaacttgcag
catgagcgcatcgtgcagtactatggctgtctgcgggaccgcgctgagaagaccctgacc
atcttcatggagtacatgccagggggctcggtgaaagaccagttgaaggcttacggtgct
ctgacagagagcgtgacccgaaagtacacgcggcagatcctggagggcatgtcctacctg
cacagcaacatgattgttcaccgggacattaagggagccaacatcctccgagactctgct
gggaatgtaaagctgggggactttggggccagcaaacgcctgcagacgatctgtatgtcg
gggacgggcatgcgctccgtcactggcacaccctactggatgagccctgaggtgatcagc
ggcgagggctatggaaggaaagcagacgtgtggagcctgggctgcactgtggtggagatg
ctgacagagaaaccaccgtgggcagagtatgaagctatggccgccatcttcaagattgcc
acccagcccaccaatcctcagctgccctcccacatctctgaacatggccgggacttcctg
aggcgcatttttgtggaggctcgccagagaccttcagctgaggagctgctcacacaccac
tttgcacagctcatgtactga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101149805
Entry
101149805         CDS       T02442                                 

Gene name
MAP3K2
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 2
  KO
K04420  mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04540  Gap junction
ggo04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101149805 (MAP3K2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101149805 (MAP3K2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101149805 (MAP3K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101149805 (MAP3K2)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101149805 (MAP3K2)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: STE group
  STE11 family
   101149805 (MAP3K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Kinase-like FTA2 Kdo
Other DBs
NCBI-GeneID: 101149805
NCBI-ProteinID: XP_004032561
Ensembl: ENSGGOG00000004601
UniProt: G3QPL7
LinkDB
Position
2B
AA seq 619 aa
MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFP
RPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLV
INGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARN
GSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSY
PDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSLRSPVS
FSPTDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGK
LLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQ
YYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIV
HRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR
KADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVE
AKLRPSADELLRHMFVHYH
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggatgatcagcaagctttgaactcaatcatgcaagatttggctgtccttcataaggcc
agtcgaccagcattatccttgcaggaaaccagaaaagcaaaatcttcatcaccaaaaaaa
cagaatgatgtccgagtcaaatttgaacatagaggagaaaaaagaatccttcagttcccc
agaccagttaaactggaagatctgagatctaaagctaaaattgcctttggacagtctatg
gatctacattataccaataacgagttggtaattccattaactactcaagatgacttggac
aaagctgtggaactgctggatcgtagtattcatatgaagagcctcaagatattacttgta
ataaatggaagtacacaggctactaatttagaaccattgccatcactagaagatttggat
aatacagtatttggagcagagaggaaaaaacggctatctataataggtcctactagtaga
gatagaagttctcctcccccaggttacattccagatgaattacaccaggttgcccggaat
gggtcattcactagtatcaacagtgaaggagagttcattccagagagcatggaccaaatg
ctggatccattatctttaagcagccctgaaaattctggctcaggaagttgtccatcactt
gatagtcctttggatggagagagctatccaaaatcacgaatgcctagggctcagagctac
ccagataatcatcaggaattttcagactatgataaccctatctttgagaaatttggaaaa
ggaggaacatatccaagaaggtatcatgtttcatatcatcatcaagagtataatgatggt
cgtaaaacttttccaagagctagaaggacccaggggaccagcttacggtctcctgtgagt
ttcagtcctactgatcattccttaagcactagtagtggaagcagtatctttaccccagag
tatgatgatagtcgaataagaagaaggggaagtgacatagacaatcctactttgaccgta
atggacatcagcccacccagccgttcacctcgagctccgaccaactggagattgggcaaa
ctgcttggccaaggagcctttggaagggtctacctctgttatgatgttgatacaggaaga
gaactggctgttaagcaagttcaatttgaccccgatagtcctgagaccagcaaggaagta
aatgcacttgagtgtgaaattcagttgctgaaaaacttgctacatgagcgaattgttcag
tattatggctgtttgagggatccccaggaaaaaacactttccatatttatggaatatatg
ccagggggttcaattaaggaccaattaaaagcatatggcgctcttactgagaatgtgact
aggaaatacacccgtcagattctggagggtgtccattatttgcacagtaatatgattgtc
catagagatatcaaaggcgcaaatatcctgcgagattcaacaggcaacgtcaaactagga
gattttggggccagcaaacggcttcagaccatctgtctctcagggacaggaatgaagtct
gtcacgggcacaccatactggatgagccctgaagtcatcagtggagaaggctatggaaga
aaagcagacatctggagtgttgcatgtactgtggtagaaatgctaactgaaaagccgcct
tgggctgaatttgaagcaatggctgccatttttaaaatcgccactcagccaacaaaccca
aagctgccacctcatgtctcagactatactcgagatttcctcaaacggatttttgtagag
gccaaactgagaccttcagctgatgaactcttaaggcacatgtttgtgcattatcactag

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101152649
Entry
101152649         CDS       T02442                                 

Gene name
MAP3K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 4 isoform X1
  KO
K04428  mitogen-activated protein kinase kinase kinase 4 [EC:2.7.11.25]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101152649 (MAP3K4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101152649 (MAP3K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101152649 (MAP3K4)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101152649 (MAP3K4)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: STE group
  STE11 family
   101152649 (MAP3K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 101152649
NCBI-ProteinID: XP_004044969
Ensembl: ENSGGOG00000008360
UniProt: G3RYN0
LinkDB
Position
6
AA seq 1606 aa
MREAAAALVPPPAFAVTPAAAMEEPPPPPPPPPPPPEPETESEPECCLAARQEGTLGDSA
CKSPESDLEDFSDETNTENLYGTSPPSTPRQMKRMSTKHQRNNVGRPASRSNLKEKMNAP
NQPPHKDTGKTVENVEEYSYKQEKKIRAALRTTERDHKKNVQCSFMLDSVGGSLPKKSIP
DVDLNKPYLSLGCSNAKLPVSVPMPIARPARQTSRTDCPADRLKFFETLRLLLKLTSVSK
KKDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQDFFLYTARQAIPDIINEILT
FKVDYGSFAFVRDGAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQRQRVSFEQVKRIMEL
LEYIEALYPSLQALQKDYEKYAAKDFQDRVQALCLWLNITKDLNQKLRIMGTVLGIKNLS
DIGWPVFEIPSPRPSKGNEPEYEGDDTEGELKELESSTDESEEEQISDPRVPEIRQPIDN
SFDIQSRDCISKKLERLESEDDSLGWGAPDWSTEAGFSRHCLTSIYRPFVDKALKQMGLR
KLILRLHKLMDGSLQRARIALVKNDRPVEFSEFPDPMWGSDYVQLSRTPPSSEQKCSAVS
WEELKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLK
GGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEEDLHKMLMVYFDYMRSWIQMLQQLPQASH
SLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTS
ADDSSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRD
LLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEKSIILQLLNAAAGKDCSKDSDDVLIDAY
LLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRK
AFQQSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEV
DESESVTLQQYYREAMIQGYNFGFEYHKEVVRLMSGEFRQKIGDKYISFARKWMNYVLTK
CESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGL
YLAIHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAVAA
SRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAY
PRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVC
DTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHK
TIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRL
YSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNST
LGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGMGH
KPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLDHSFVKVCTDEE
NT seq 4821 nt   +upstreamnt  +downstreamnt
atgagagaagccgctgccgcgctggtccctcctcccgcctttgccgtcacgcctgccgcc
gccatggaggagccgccgccaccgccgccgccgccaccaccgccgccggaacccgagacc
gagtcagaacccgagtgctgcttggcggcgaggcaagagggcacattgggagattcagct
tgcaagagtcctgaatctgatctagaagacttctccgatgaaacaaatacagagaatctt
tatggtacctctccccccagcacacctcgacagatgaaacgcatgtcaaccaaacatcag
aggaataatgtggggaggccagccagtcggtctaatttgaaagaaaaaatgaatgcacca
aatcagcctccacataaagacactggaaaaacagtggagaatgtggaagaatacagctat
aagcaggagaaaaagatccgagcagctcttagaacaacagagcgtgatcataaaaaaaat
gtacagtgctcattcatgttagactcagtgggtggatctttgccaaaaaaatcaattcca
gatgtggatctcaataagccttacctcagccttggctgtagcaatgctaagcttccagta
tctgtgcccatgcctatagccagacctgcacgccagacttctaggactgactgtccagca
gatcgtttaaagttttttgaaacattacgacttttgctaaagcttacctcagtctcaaag
aaaaaagacagggagcaaagaggacaagaaaatacgtctggtttctggcttaaccgatct
aacgaactgatctggttagagctacaagcctggcatgcgggacggacaattaacgaccag
gacttctttttatatacagcccgtcaagccatcccagatattattaatgaaatccttact
ttcaaagtcgactatgggagcttcgcctttgttagagatggagctggttttaatggtact
tcagtagaagggcagtgcaaagccactcctggaacaaagattgtaggttactcaacacat
catgagcatctccaacgccagagggtctcatttgagcaggtaaaacggataatggaactg
ctagagtacatagaagcactttatccatcattgcaggctcttcagaaggactatgaaaaa
tatgctgcaaaagacttccaggacagggtgcaggcactctgtttgtggttaaacatcaca
aaagacttaaatcagaaattaaggattatgggcactgttttgggcatcaagaatttatca
gacattggctggccagtgtttgaaatcccttcccctcgaccatccaaaggtaatgagccg
gagtatgagggtgatgacacagaaggagaattaaaggagttggaaagtagtacggatgag
agtgaagaagagcaaatctctgatcctagggtaccggaaatcagacagcccatagataac
agcttcgacatccagtcgcgggactgcatatccaagaagcttgagaggcttgaatctgag
gatgattctcttggctggggagcaccagactggagcacagaagcaggctttagtagacat
tgtctgacttctatttatagaccatttgtagacaaagcactgaagcagatggggttaaga
aagttaattttaagacttcacaagctaatggatggttccttgcaaagggcacgtatagca
ttggtaaagaacgatcgtccagtggagttttctgaatttccagatcccatgtggggttca
gattatgtgcagttgtcaaggacaccaccttcatctgagcagaaatgcagtgctgtgtcg
tgggaggagctgaaggccatggatttaccttcattcgaacctgccttcctagttctctgc
cgagtccttctgaatgtcatacatgagtgtctgaagttaagattggagcagagacctgct
ggagaaccatctctcctgagtattaagcagttggtgagagagtgtaaggaggtcctgaag
ggcggcctgctgatgaaacagtactaccagttcatgctgcaggaggttctggaggacttg
gagaagcccgactgcaacattgacgcttttgaagaggatctacataaaatgcttatggtg
tattttgattacatgagaagctggatccaaatgctacagcaattacctcaagcatcacat
agtttaaaaaatctgttagaagaagaatggaatttcaccaaagaaataactcattacata
cggggaggagaagcacaggccgggaagcttttctgtgacattgcaggaatgctgctgaaa
tctacaggaagttttttagaatttggcttacaggagagctgtgctgaattttggactagt
gcggatgacagcagtgcttccgacgaaatcaggaggtctgttatagagatcagtcgagcc
ctgaaggagctcttccatgaagccagagaaagggcttccaaagcacttggatttgctaaa
atgttgagaaaggacctggaaatagcagcagaattcaggctttcagccccagttagagac
ctcctggatgttctgaaatcaaaacagtatgtcaaggtgcaaattcctgggttagaaaac
ttgcaaatgtttgttccagacactcttgctgaggagaagagtattattttgcagttactc
aatgcagctgcaggaaaggactgttcgaaagattcagatgacgtactcatcgatgcctat
ctgcttctgaccaagcacggtgatcgagcccgtgattcagaggacagctggggcacctgg
gaggcacagcctgtcaaagtcgtgcctcaggtggagactgttgacaccctgagaagcatg
caggtggataatcttttactagttgtcatgcagtctgcccatctcacaattcagagaaaa
gctttccagcagtccattgagggacttatgactctgtgccaggagcagacatccagtcag
ccggtcatcgccaaagctttgcagcagctgaagaatgatgcattggagctatgcaacaga
ataagcaatgccattgaccgcgtggaccacatgttcacatcagaatttgatgctgaggtt
gatgaatctgaatctgtcaccttgcaacagtactaccgagaagcaatgattcaggggtac
aattttggatttgagtatcataaagaagttgttcgtttgatgtctggggagtttagacag
aagataggagacaaatatataagctttgcccggaagtggatgaattatgtcctgactaaa
tgtgagagtggtagaggtacaagacccaggtgggcgactcaaggatttgattttctgcaa
gcaattgaacctgcctttatttcagctttaccagaagatgacttcttgagtttacaagcc
ttgatgaatgaatgcattggccatgtcataggaaaaccacacagtcctgttacaggtttg
taccttgccattcatcggaacagcccccgtcctatgaaggtacctcgatgccatagtgac
cctcctaacccacacctcattatccccactccagagggattcagcactcggagcatgcct
tccgacgcgcggagccacggcagccctgctgctgctgctgctgctgctgctgttgctgcc
agtcggcccagcccctctggtggtgactctgtgctgcccaaatccatcagcagtgcccat
gataccaggggttccagcgttcctgaaaatgatcgattggcttccatagctgctgaattg
cagtttaggtccctgagtcgtcactcaagccccacggaggagcgagacgaaccagcatat
ccaagaggagattcaagtgggtccacaagaagaagttgggaacttcggacactaatcagc
cagagtaaagatactgcttctaaactaggacccatagaagctatccagaagtcagtccga
ttgtttgaagaaaagaggtaccgagaaatgaggagaaagaatatcattggtcaagtttgt
gatacgcctaagtcctatgataatgttatgcatgttggcttgaggaaggtgaccttcaaa
tggcaaagaggaaacaaaattggagaaggccagtatgggaaggtgtacacctgcatcagc
gtcgacaccggggagctgatggccatgaaggagattcgatttcaacctaatgaccataag
actatcaaggaaactgcagatgaattgaaaatattcgaaggcatcaaacaccccaatctg
gttcggtattttggtgtggagctccatagagaagaaatgtacatcttcatggagtactgc
gatgaggggactttagaagaggtgtcaaggctgggacttcaggaacatgtgattaggctg
tattcaaagcagatcaccattgcgatcaacgtcctccatgagcatggcatagtccaccgt
gacattaaaggtgccaatatcttccttacctcatctggattaatcaaactgggagatttt
ggatgttcagtaaagctcaaaaacaatgcccagaccatgcctggtgaagtgaacagcacc
ctggggacagcagcatacatggcacctgaagtcatcactcgtgccaaaggagagggccat
gggcgtgcggccgacatctggagtctggggtgtgttgtcatagagatggtgactggcaag
aggccttggcatgagtatgagcacaactttcaaattatgtataaagtggggatgggacat
aagccaccaatccctgaaagattaagccctgaaggaaaggacttcctttctcactgcctt
gagagtgacccaaagatgagatggaccgccagccagctcctcgaccattcgtttgtcaag
gtttgcacagatgaagaatga

DBGET integrated database retrieval system