KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101137450
Entry
101137450         CDS       T02442                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7 isoform X1
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04540  Gap junction
ggo04657  IL-17 signaling pathway
ggo04722  Neurotrophin signaling pathway
ggo04912  GnRH signaling pathway
ggo04921  Oxytocin signaling pathway
ggo05206  MicroRNAs in cancer
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101137450 (MAPK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101137450 (MAPK7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101137450 (MAPK7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101137450 (MAPK7)
   04921 Oxytocin signaling pathway
    101137450 (MAPK7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101137450 (MAPK7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101137450 (MAPK7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101137450 (MAPK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101137450 (MAPK7)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101137450 (MAPK7)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101137450 (MAPK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH Rrn6
Other DBs
NCBI-GeneID: 101137450
NCBI-ProteinID: XP_004042177
Ensembl: ENSGGOG00000006045
UniProt: G3QTA1
LinkDB
Position
5
AA seq 814 aa
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPASEPAPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPAPTSVPAPAPAPTPTPAQP
TSPPPGPVAQPTGPQPQPAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPAPPQIATSTS
LLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKSQV
EDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWL
EGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
NT seq 2445 nt   +upstreamnt  +downstreamnt
atggccgagcctctgaaggaggaagacggcgaggacggctctgcggagccccccgggccc
gtgaaggccgaacccgcccacaccgctgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcatcgagacc
ataggcaacggggcctatggagtggtgtcctccgcccgccgccgcctcaccggccagcag
gtggccatcaagaagatccctaatgctttcgatgtggtgaccaatgccaagcggaccctc
agggagctgaagatcctcaagcactttaagcacgacaacatcatcgccatcaaggacatc
ctgaggcccaccgtgccctatggcgaattcaaatctgtctacgtggtcctggacctgatg
gaaagcgacctgcaccagatcatccactcctcacagcccctcacactggaacacgtgcgc
tacttcctgtaccaactgctgcggggcctgaagtacatgcactcggctcaggtcatccac
cgtgacctcaagccctccaacctattggtgaatgagaactgtgagctcaagattggtgac
tttggtatggctcgtggcctgtgcacctcgcctgctgaacatcagtacttcatgacggag
tatgtggccacgcgctggtaccgtgcgcccgagctcatgctctctttgcatgagtataca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggcccggcgccag
ctcttcccaggcaaaaactatgtacaccagctacagctcatcatgatggtgctgggtacc
ccatcaccagccgtgattcaggctgtgggggctgagagggtgcgggcctatatccagagc
ttgccaccacgccagcctgtgccctgggagacagtgtacccaggtgccgaccgccaggcc
ctatcactgctgggtcgcatgctgcgttttgagcccagcgcccgcatctcagcagctgct
gcccttcgccaccctttcctggccaagtaccatgatcctgatgatgagcctgactgtgcc
ccgccctttgactttgcctttgaccgcgaagccctcactcgggagcgcattaaggaggcc
attgtggctgaaattgaggacttccatgcaaggcgtgagggcatccgccaacagatccgc
ttccagccttctctacagcctgtggctagtgagcctggctgtccagatgttgaaatgccc
agtccctgggctcccagtggggactgtgccatggagtctccaccaccagccccgccaccg
tgccctggccctgcacctgacactattgatctgaccctgcagccacctccaccagccagt
gagcctgccccaccaaagaaagagggtgccatctcagacaatactaaggctgcccttaaa
gctgccctgctcaagtctttgaggagccggctcagagatggccccagcgcacccctggag
gctcctgagcctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggaggcggcaagaacgagccaaggagcgggagaaacggcggcaggagcgggagcga
aaggaacggggggctggggcctctgggggcccctccactgaccccttggctggactagtg
ctcagtgacaatgacagaagcctgttagaacgctggactcgaatggcccggcccccagcc
ccagcccccacctctgtgccggcccctgccccagcgccaacgccaaccccagcccaacct
accagtcctcctcctggccctgtagcccagcccactggcccgcaaccacaacctgcgggc
tctacctctggccctgtaccccagcctgcctgcccaccccctggccctgcaccccacccc
actggccctcctgggcccatccctgtccccgcgccaccccagattgccacctccaccagc
ctcctggctgcccagtcacttgtgccaccccctgggctgcctggctccagcaccccagga
gttttgccttacttcccacctggcctgccgcccccagacgccgggggagcccctcagtct
tccatgtcagagtcacctgatgtcaaccttgtgacccagcagctatctaagtcacaggtg
gaggaccccctgccccctgtgttctcaggcacaccaaagggcagtggggctggctacggt
gttggctttgacctggaggaattcttaaaccagtctttcgacatgggcgtggctgatggg
ccacaggatggccaggcagattcagcctctctctcagcctccctgcttgctgactggctc
gaaggccatggcatgaaccctgccgatattgagtccctgcagcgtgagatccagatggac
tccccaatgctgctggctgacctgcctgacctccaggacccctga

DBGET integrated database retrieval system