KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138135Help
Entry
101138135         CDS       T02442                                 

Gene name
PPCS
Definition
(RefSeq) phosphopantothenate--cysteine ligase isoform X1
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00770  Pantothenate and CoA biosynthesis
ggo01100  Metabolic pathways
Module
ggo_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    101138135 (PPCS)
Enzymes [BR:ggo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     101138135 (PPCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP Collectrin
Motif
Other DBs
NCBI-GeneID: 101138135
NCBI-ProteinID: XP_004025620
Ensembl: ENSGGOG00000026253
UniProt: G3S9J8
LinkDB All DBs
Position
1
AA seq 311 aa AA seqDB search
MAEMDPVAEFPQPPGAARWAEVMARFAARLGAQGRRVVLVTSGGTKVPLEARPVRFLDNF
SSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEA
EENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAA
VSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKLLSPLVKDWAPKAFIISFKLETDPAIVI
NRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLLSEEEIEKGIEIEEKIVDNLQ
SRHTAFIGDKN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatggatccggtagccgagttcccccagcctcccggtgctgcgcgctgggct
gaggttatggctcgcttcgcggccaggctgggcgcgcagggccggcgggtggtgttggtt
acgtcaggcggcaccaaggtcccactggaagcgcggccggtgcgcttcctggacaacttc
agcagcgggcggcgcggtgcaacctcggccgaggccttcctagccgccggctacggggtc
ctgttcttgtatcgcgctcgctctgccttcccctatgcccaccgcttcccaccccagact
tggctgtccgctctgcggccttcgggcccagccctttcgggcttgctgagcctggaggcg
gaggagaatgcacttccgggttttgctgaggctctgaggagctaccaggaggctgcggct
gcaggcaccttcctggtggtagagttcaccactttggcggactatttgcatctgttgcag
gctgcggcccaggcactcaatccgctaggcccttctgcgatgttttacctggctgcggct
gtgtcagatttctatgttcctgtctctgaaatgcctgaacacaagatccagtcatctggg
ggcccactgcagataacaatgaagatggtgccaaaactgctttctcctttggttaaagat
tgggctcccaaagcatttataatttcctttaagttggagactgaccccgccattgtaatt
aatcgagctcggaaggctttggaaatttatcagcatcaagtggtggtggctaatatcctt
gagtcacgacagtcctttgtgtttattgtaaccaaagactcggaaaccaagttattgcta
tcagaggaagaaatagaaaaaggcatagagatagaagagaagatagtggataatcttcag
tctcgacacacagcttttataggtgacaaaaactga

DBGET integrated database retrieval system