KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138839Help
Entry
101138839         CDS       T02442                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00010  Glycolysis / Gluconeogenesis
ggo00052  Galactose metabolism
ggo00500  Starch and sucrose metabolism
ggo00520  Amino sugar and nucleotide sugar metabolism
ggo00524  Neomycin, kanamycin and gentamicin biosynthesis
ggo01100  Metabolic pathways
ggo01200  Carbon metabolism
ggo04910  Insulin signaling pathway
ggo04911  Insulin secretion
ggo04917  Prolactin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04930  Type II diabetes mellitus
ggo04950  Maturity onset diabetes of the young
ggo05230  Central carbon metabolism in cancer
Module
ggo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ggo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101138839 (GCK)
   00052 Galactose metabolism
    101138839 (GCK)
   00500 Starch and sucrose metabolism
    101138839 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    101138839 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101138839 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101138839 (GCK)
   04910 Insulin signaling pathway
    101138839 (GCK)
   04922 Glucagon signaling pathway
    101138839 (GCK)
   04917 Prolactin signaling pathway
    101138839 (GCK)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    101138839 (GCK)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101138839 (GCK)
   04950 Maturity onset diabetes of the young
    101138839 (GCK)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     101138839 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 VIT1 DUF4795
Motif
Other DBs
NCBI-GeneID: 101138839
NCBI-ProteinID: XP_004045420
Ensembl: ENSGGOG00000001501
UniProt: A0A2I2ZDN4
LinkDB All DBs
Position
7
AA seq 465 aa AA seqDB search
MLDDRARMEATKKEKVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
VVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMGE
LVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRPS
TTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
EQFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgacagagccaggatggaggccaccaagaaggagaaggtagagcagatcctg
gcagagttccagctgcaggaggaggacttgaagaaggtcatgagacggatgcagaaggag
atggaccgtggcctgaggctggagacccatgaagaggccagtgtgaagatgctgcccacc
tacgtgcgctccaccccagaaggctcagaagtcggggacttcctctccctggacctgggt
ggcactaacttcagggtgatgctggtgaaggtgggagaaggtgaggaggggcagtggagc
gtgaagaccaaacaccagatgtactccatccccgaggacgccatgaccggcactgctgag
atgctcttcgactacatctctgagtgcatctccgacttcctggacaagcatcagatgaag
cacaagaagctgcccctgggcttcaccttctcctttcctgtgaggcacgaagacatcgat
aagggcatccttctcaactggaccaagggcttcaaggcctcaggagcagaagggaacaac
gtcgtggggcttctgcgagacgctatcaaacggagaggggactttgaaatggatgtggtg
gcaatggtgaatgacacggtggccacgatgatctcctgctactacgaagaccatcagtgc
gaggtcggcatgatcgtgggcacgggctgcaatgcctgctacatggaggagatgcagaat
gtggagctggtggagggggacgagggccgcatgtgcgtcaataccgagtggggcgccttc
ggggactccggcgagctggacgagttcctgctggagtatgaccgcctggtggacgagagc
tctgcaaaccccggtcagcagctgtatgagaagctcataggtggcaagtacatgggcgag
ctggtgcggctcgtgctgctcaggctcgtggacgaaaacctgctcttccacggggaggcc
tccgagcagctgcgcacacgcggagccttcgagacgcgcttcgtgtcgcaggtggagagc
gacacgggcgaccgcaagcagatctacaacatcctgagcacgctggggctgcgaccctcg
accaccgactgcgacatcgtgcgccgcgcctgcgagagcgtgtctacgcgcgctgcgcac
atgtgctcggcagggctggcgggcgtcatcaaccgcatgcgcgagagccgcagcgaggac
gtaatgcgcatcactgtgggcgtggatggctccgtgtacaagctgcaccccagcttcaag
gagcagttccatgccagcgtgcgcaggctgacgcccagctgcgagatcaccttcatcgag
tcggaggagggcagtggccggggcgcggccctggtctcggcggtggcctgtaagaaggcc
tgcatgctgggccagtga

DBGET integrated database retrieval system