KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138938
Entry
101138938         CDS       T02442                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04012  ErbB signaling pathway
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo05171  Coronavirus disease - COVID-19
ggo05205  Proteoglycans in cancer
ggo05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101138938 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101138938 (HBEGF)
   04915 Estrogen signaling pathway
    101138938 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    101138938 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101138938 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    101138938 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101138938 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101138938 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ggo00536]
    101138938 (HBEGF)
Glycosaminoglycan binding proteins [BR:ggo00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101138938 (HBEGF)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 101138938
NCBI-ProteinID: XP_004042668
Ensembl: ENSGGOG00000000286
UniProt: G3QDG3
LinkDB
Position
5
AA seq 208 aa
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGVGRDRK
VRDLQEADLDLLRVTLSSKPQALATPSKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtgctgaagctctttctggctgcagttctctcggcactg
gtgactggcgagagcctggagcggcttcggagagggctagctgctggaaccagcaacccg
gaccctcccactgtatccacggaccagctgctacccctaggagtcggccgggaccggaaa
gtccgtgacttgcaagaggcagatctggaccttttgagagtcactttatcctccaagcca
caagcactggccacaccaagcaaggaggagcacgggaaaagaaagaagaaaggcaagggg
ctagggaagaagagggacccatgtcttcggaaatacaaggacttctgcatccatggagaa
tgcaaatatgtgaaggagctccgggctccctcctgcatctgccacccgggttaccatgga
gagaggtgtcatgggctgagcctcccagtggaaaatcgcttatatacctatgaccacaca
accatcctggccgtggtggctgtggtgctgtcatctgtctgtctgctggtcatcgtgggg
cttctcatgtttaggtaccataggagaggaggttatgatgtggaaaatgaagagaaagtg
aagttgggcatgactaattcccactga

DBGET integrated database retrieval system