KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101139584
Entry
101139584         CDS       T02442                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04137  Mitophagy - animal
ggo04141  Protein processing in endoplasmic reticulum
ggo04151  PI3K-Akt signaling pathway
ggo04210  Apoptosis
ggo04211  Longevity regulating pathway
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04668  TNF signaling pathway
ggo04720  Long-term potentiation
ggo04722  Neurotrophin signaling pathway
ggo04725  Cholinergic synapse
ggo04728  Dopaminergic synapse
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04918  Thyroid hormone synthesis
ggo04922  Glucagon signaling pathway
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04932  Non-alcoholic fatty liver disease
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo05010  Alzheimer disease
ggo05012  Parkinson disease
ggo05014  Amyotrophic lateral sclerosis
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05030  Cocaine addiction
ggo05031  Amphetamine addiction
ggo05034  Alcoholism
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05203  Viral carcinogenesis
ggo05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101139584 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101139584 (ATF4)
   04668 TNF signaling pathway
    101139584 (ATF4)
   04022 cGMP-PKG signaling pathway
    101139584 (ATF4)
   04151 PI3K-Akt signaling pathway
    101139584 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101139584 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    101139584 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101139584 (ATF4)
   04922 Glucagon signaling pathway
    101139584 (ATF4)
   04912 GnRH signaling pathway
    101139584 (ATF4)
   04915 Estrogen signaling pathway
    101139584 (ATF4)
   04926 Relaxin signaling pathway
    101139584 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    101139584 (ATF4)
   04918 Thyroid hormone synthesis
    101139584 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    101139584 (ATF4)
   04925 Aldosterone synthesis and secretion
    101139584 (ATF4)
   04927 Cortisol synthesis and secretion
    101139584 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101139584 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    101139584 (ATF4)
   04728 Dopaminergic synapse
    101139584 (ATF4)
   04720 Long-term potentiation
    101139584 (ATF4)
   04722 Neurotrophin signaling pathway
    101139584 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    101139584 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101139584 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    101139584 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101139584 (ATF4)
   05012 Parkinson disease
    101139584 (ATF4)
   05014 Amyotrophic lateral sclerosis
    101139584 (ATF4)
   05020 Prion disease
    101139584 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    101139584 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    101139584 (ATF4)
   05031 Amphetamine addiction
    101139584 (ATF4)
   05034 Alcoholism
    101139584 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101139584 (ATF4)
   04934 Cushing syndrome
    101139584 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101139584 (ATF4)
   05161 Hepatitis B
    101139584 (ATF4)
   05163 Human cytomegalovirus infection
    101139584 (ATF4)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    101139584 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 DUF4795 DUF4407 Fez1 Nop53 Laminin_II AAA_13 bZIP_Maf
Other DBs
NCBI-GeneID: 101139584
NCBI-ProteinID: XP_018873846
Ensembl: ENSGGOG00000010115
UniProt: G3R3N8
LinkDB
Position
22
AA seq 351 aa
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTC
DLFAPLVQETNKEPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSL
ELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRG
SPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaccgaaatgagcttcctgagcagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagatgattacctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtccctccaacaacagcaaggaggatgccttctcc
gggacagattggatgttggagaaaatggatttgaaggagttcgacttggatgccctgttg
ggtatagatgacctggaaaccatgccagatgaccttctgaccacgttggatgacacttgt
gatctctttgcccccttagtccaggagactaataaggagcccccccagacggtgaaccca
attggccatctcccagaaagtttaacaaaacccgaccaggttgcccccttcaccttcttg
caacctcttcccctttccccaggggtcctgtcctccactccagatcattcctttagttta
gagctgggcagtgaggtggatatcactgaaggagataggaagccagactacactgcttac
gttgccatgatccctcagtgcataaaggaggaagacaccccttcagataatgatagtggc
atctgtatgagcccagagtcctatctggggtctcctcagcacagcccctctaccaggggc
tctccaaataggagcctcccatctccaggtgttctctgtgggtctgcccgccccaaacct
tacgatcctcctggagagaagatggtagcagcaaaagtaaagggtgagaaactggataag
aagctgaaaaaaatggagcaaaacaagacagcagccactaggtaccgccagaagaagagg
gcggagcaggaggctcttactggcgagtgcaaagagctggaaaagaagaacgaggctcta
aaagagagggcggattccctggccaaggagatccagtacctgaaagatttgatagaagag
gtccgcaaggcaagggggaagaaaagggtcccctag

DBGET integrated database retrieval system