KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101139668Help
Entry
101139668         CDS       T02442                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04614  Renin-angiotensin system
ggo04924  Renin secretion
ggo05142  Chagas disease (American trypanosomiasis)
ggo05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    101139668
   04614 Renin-angiotensin system
    101139668
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101139668
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    101139668
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ggo01002]
    101139668
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101139668
   04090 CD molecules [BR:ggo04090]
    101139668
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101139668
Peptidases [BR:ggo01002]
 Metallo Peptidases
  Family M2
   101139668
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101139668
CD molecules [BR:ggo04090]
 Proteins
  101139668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 101139668
NCBI-ProteinID: XP_018881784
LinkDB All DBs
Position
5
AA seq 751 aa AA seqDB search
MELASPSSAALLVMGARWTCPGPSLLVLLCYGQLLPWLRIKGEHSLDNFYNETEAKIFPQ
FYDQTGEVVLNKFMEATWNYVTNITRKNQEEMLHKDMERSXFMIYFGTQARLFKVTEFKD
PDVNGMLSKLQNIDKVTLSRDELREYNELLAYMEMTYSMAQVCLNEGPCLSLEPELEVMA
TSRDKEELLWAWQGWQDAVGRQICTTFEHYVELSNKAAQLNGYKDMGALWRSKYESDTLE
QDLERLFQELRPLYVDLHTYVRRALHRHYGPELIDLTGPIPAHLLENTLAQSWVNILDPI
LPFLKKIPEDVTKIMKVQHWKPEKMLEEAETFFTSLALPPAPPSFWKKLMLMRPTDGREV
ECHISAWNFYQDDDFRIEKCTEVTTEDPLSIFHEMGHXQYFLQYKNLSVIFRAGANPAFE
EAVGSVITLSASSHKHLLNIGLLSLXHQDSEDEVNFLMHIALEKIAFIPFGYLMDLFHWK
VFDGTIWKDIYDQEWWNLRLKYQGLCPAIPHSEEDFDPGAKFHISAGVPYIRYFLSLVLQ
FQYHETLCKASGHMGPLHQCDIYNSKIAGKLLGDALKLGSSKPWPEVLKMLTGESEVSTK
VFMTYFKPLLTWLVTXNMQQGDILGWPDFSCSFEEKDTDKVTFLSLKLDPNQAKFGYWVL
LALGFVMSLVVLGLACRLQCLEKQSLTQDTEIFSPLPNASFLGIDMEPCQAAKGQWMLLG
LCLVLMLCSISLAIWIFTQXSRKPPWVRAEW
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggagctggcctcacccagctctgctgctctcttggtcatgggagcaaggtggacttgc
cctggaccttccctacttgtgctcctctgttatgggcagctcttgccttggctcaggatc
aagggtgaacacagtttagataacttctacaatgagaccgaggccaagatcttcccgcag
ttttatgaccaaacaggtgaagttgtgttgaacaagttcatggaggccacttggaactat
gtcaccaacatcaccaggaaaaatcaggaggagatgctgcacaaggacatggagaggtcc
tagttcatgatttactttggcacccaggcccgcctgtttaaagtcaccgagttcaaggac
ccggatgtgaatggcatgctgagtaagctgcagaacatagacaaggtgactctgtccagg
gacgagctgcgggagtataacgagcttctggcctacatggagatgacatacagtatggcc
caggtgtgcctgaatgaggggccctgcctgtccctggagcctgaactcgaagtcatggcc
acctccagggacaaagaggagctgctgtgggcctggcagggctggcaggatgccgtgggc
cgccagatctgcaccaccttcgagcactatgtggagctcagcaacaaggctgcacagctc
aacggttacaaagacatgggggccttgtggcgctccaagtatgagtcggataccctggag
caagacctggagcggctattccaggagctgcggccactctacgtggacctgcacacctat
gtgcgcagggccctccaccgccactatgggcccgagctcatcgacctgacggggcccatc
cctgcccacctcctggagaacacgttggctcagtcctgggtcaacatcttagacccgatc
ctgcccttcctgaagaagatcccagaggatgtcacaaagatcatgaaagtccagcactgg
aagccagagaaaatgttggaagaggctgagacattcttcacctccttggcgctgccacct
gccccacccagtttctggaaaaagttgatgctaatgaggccaaccgatgggcgagaggtg
gagtgtcacatctctgcctggaacttctaccaggacgacgatttcagaatagagaagtgc
acggaagtgaccacagaagacccgctctccatcttccacgaaatgggccatntccagtac
ttcctgcagtacaagaacctctccgtcatcttccgcgcaggcgccaacccagcctttgaa
gaggctgtggggtctgtgatcaccctctcggcctcctcccacaagcacctgctcaacata
ggcctgctcagcctctagcaccaggactcagaggatgaggtcaatttcctgatgcatatt
gccctggagaagatcgccttcatccccttcggctacctgatggacctgtttcactggaag
gtctttgacggcaccatctggaaggacatctacgatcaggagtggtggaacctcaggttg
aaataccagggcttgtgccccgctattcctcactcagaggaagactttgatccaggtgcc
aagttccacatttctgctggtgtgccctacatacggtacttcctcagtctggtgctccag
ttccagtaccatgaaacactgtgcaaagcctcgggccacatgggtccactgcaccagtgt
gacatctacaactccaagattgccgggaagctcctgggggatgctctaaagctgggctca
agcaagccctggccagaggtcctaaagatgctgactggggagtctgaggtgtctacaaag
gtcttcatgacctacttcaaacccctactgacctggctggtgacanngaacatgcagcaa
ggggacatcttaggctggccagacttcagctgttcctttgaagaaaaagacacagacaaa
gtgacattcctgagtctgaagctggaccccaaccaggctaaatttgggtactgggtgctg
ctggccctgggctttgtcatgtctctggtggtgctggggctggcctgcaggctgcagtgc
ctggaaaaacagtcactgactcaagacactgagatattcagcccactgcccaatgcctcc
ttcctgggcatagacatggaaccctgccaggctgctaaaggacagtggatgctgctgggc
ctctgccttgtcctgatgctgtgctcaatcagcctggccatctggattttcacacagtaa
agcaggaagcctccatgggtaagagctgaatggtga

DBGET integrated database retrieval system