KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101140015
Entry
101140015         CDS       T02442                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 isoform X1
  KO
K05430  interleukin 4
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04060  Cytokine-cytokine receptor interaction
ggo04151  PI3K-Akt signaling pathway
ggo04630  JAK-STAT signaling pathway
ggo04640  Hematopoietic cell lineage
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04672  Intestinal immune network for IgA production
ggo05140  Leishmaniasis
ggo05200  Pathways in cancer
ggo05310  Asthma
ggo05320  Autoimmune thyroid disease
ggo05321  Inflammatory bowel disease
ggo05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101140015 (IL4)
   04151 PI3K-Akt signaling pathway
    101140015 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101140015 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101140015 (IL4)
   04660 T cell receptor signaling pathway
    101140015 (IL4)
   04658 Th1 and Th2 cell differentiation
    101140015 (IL4)
   04659 Th17 cell differentiation
    101140015 (IL4)
   04657 IL-17 signaling pathway
    101140015 (IL4)
   04664 Fc epsilon RI signaling pathway
    101140015 (IL4)
   04672 Intestinal immune network for IgA production
    101140015 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101140015 (IL4)
  09163 Immune disease
   05310 Asthma
    101140015 (IL4)
   05320 Autoimmune thyroid disease
    101140015 (IL4)
   05321 Inflammatory bowel disease
    101140015 (IL4)
   05330 Allograft rejection
    101140015 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101140015 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ggo04052]
    101140015 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:ggo00536]
    101140015 (IL4)
Cytokines and growth factors [BR:ggo04052]
 Cytokines
  Interleukins
   101140015 (IL4)
Glycosaminoglycan binding proteins [BR:ggo00536]
 Heparan sulfate / Haparin
  Cytokines
   101140015 (IL4)
SSDB
Motif
Pfam: IL4 Mannosyl_trans3
Other DBs
NCBI-GeneID: 101140015
NCBI-ProteinID: XP_004042527
Ensembl: ENSGGOG00000005670
UniProt: G3QSC0
LinkDB
Position
5
AA seq 153 aa
MGLTSQLLPPLFFLLACVGNFVHGHKCDIALQEIIKTLNSLTEQKTLCTELTVTDIFAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL
NSCPVKEANQSTLEDFLERLKTIMREKYSKCSS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgtcggcaac
tttgtccacggacacaagtgcgatatcgccttacaggagatcatcaaaactttgaacagc
ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatctttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgcctgggtgcgactgcacagcagttccacaggcac
aagcagctgattcgattcctgaaacggctcgacaggaacctctggggcctggcgggcttg
aattcctgtcctgtgaaggaagccaaccagagtacgttggaagacttcttggaaaggcta
aagacgatcatgagagagaaatattcaaagtgttcgagctga

DBGET integrated database retrieval system