KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101140326
Entry
101140326         CDS       T02442                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01521  EGFR tyrosine kinase inhibitor resistance
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04151  PI3K-Akt signaling pathway
ggo04915  Estrogen signaling pathway
ggo05200  Pathways in cancer
ggo05210  Colorectal cancer
ggo05211  Renal cell carcinoma
ggo05212  Pancreatic cancer
ggo05214  Glioma
ggo05215  Prostate cancer
ggo05223  Non-small cell lung cancer
ggo05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101140326 (TGFA)
   04012 ErbB signaling pathway
    101140326 (TGFA)
   04014 Ras signaling pathway
    101140326 (TGFA)
   04151 PI3K-Akt signaling pathway
    101140326 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101140326 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101140326 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101140326 (TGFA)
   05212 Pancreatic cancer
    101140326 (TGFA)
   05225 Hepatocellular carcinoma
    101140326 (TGFA)
   05214 Glioma
    101140326 (TGFA)
   05211 Renal cell carcinoma
    101140326 (TGFA)
   05215 Prostate cancer
    101140326 (TGFA)
   05223 Non-small cell lung cancer
    101140326 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101140326 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154 Lysis_col
Other DBs
NCBI-GeneID: 101140326
NCBI-ProteinID: XP_018877138
UniProt: A0A2I2ZCX9
LinkDB
Position
2A
AA seq 166 aa
MFRIGRGALDLLSELLSFGGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQF
CFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVL
IITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 501 nt   +upstreamnt  +downstreamnt
atgttcaggatcggcagaggcgccctcgatctcctttcagagctcttgagctttgggggt
attgtgttggccgcgtgccaggccttggagaacagcacgtccccgctgagcgcagacccg
cctgtggccgcagcagtggtgtcccattttaatgactgcccagattcccacactcagttc
tgcttccatggaacctgcaggtttttggtgcaggaggacaagccagcatgtgtctgccat
tctgggtacgttggtgcacgctgtgagcatgcggacctcctggccgtggtggctgccagc
cagaagaagcaggccatcaccgccttggtggtggtctccatcgtggccctggctgtcctt
atcatcacatgtgtgctgatacactgctgccaggtccgaaaacactgtgagtggtgccgg
gccctcatctgccggcacgagaagcccagcgccctcctgaagggaagaaccgcttgctgc
cactcagaaacagtggtctga

DBGET integrated database retrieval system