KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101141259Help
Entry
101141259         CDS       T02442                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00052  Galactose metabolism
ggo00500  Starch and sucrose metabolism
ggo01100  Metabolic pathways
ggo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101141259 (GAA)
   00500 Starch and sucrose metabolism
    101141259 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101141259 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101141259 (GAA)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101141259 (GAA)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101141259 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101141259
NCBI-ProteinID: XP_004040901
Ensembl: ENSGGOG00000012906
UniProt: G3RAW5
LinkDB All DBs
Position
5
AA seq 952 aa AA seqDB search
MGVRHPPCSRRLLAVYALVSLATAALLGHILLHDFLRVPRELSGSSPVLEEAHPAHQQGA
SRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLRGA
QMGQPWCFFPPSYPSYKLENLSSSEMGYMATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANRRYEVPLETPRVHSRALSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLEVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGSTAFPDFTNPTALAWWEDMVAEFHEQVPFDGMWIDMNEPSNFIRGSEDGCPNNELEN
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNGLLNLPQEPYSFSKPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPI
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIMNELVHVTSEGAGLQ
LQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDIHVSLLMGEQFLISWS
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaggcacccgccctgctcccgccggctcctggccgtctacgccctcgtgtcc
ttggcaaccgctgcactcctggggcacatcctgctccatgatttcctgcgggttccccga
gagctgagtggctcctccccagtcctggaggaggctcacccagctcaccagcagggagcc
agcaggccagggccccgggatgcccaggcacaccccggccgtcccagagcagtgcccaca
cagtgcgacgtcccccccaacagccgcttcgattgcgcccctgacaaggccatcacccag
gaacagtgcgaggcccgcggctgctgctacatacctgcaaagcaggggctgcggggagcc
cagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaac
ctgagctcctctgaaatgggctacatggccaccctgacccgtaccacccccaccttcttc
cccaaggacatcctgaccctgcggctggacgtgatgatggagactgagaaccgcctccac
ttcacgatcaaagatccagctaacaggcgctacgaggtgcccttggagaccccgcgtgtc
cacagccgggcactgtccccactctacagcgtggagttctccgaggagcccttcggggtg
atcgtgcgccggcagctggacggccgcgtgctgctgaacacgacggtggcgcccctgttc
tttgcggaccagttccttcagctgtccacctcgctgccctcgcagtacatcacaggcctc
gccgagcacctcagtcctctgatgctcagcaccagctggaccaggatcaccctgtggaac
cgggacctcgcgcccacgcccggtgcgaacctctacgggtctcaccctttctacctggcg
ctggaggacggcgggtcggcacacggggtgttcctgctgaacagcaatgccatggatgtg
gtcctgcagccaagccctgcccttagctggaggtcgacaggtgggatcctggatgtctac
atcttcctgggcccagagcccaagagcgtcgtgcagcagtacctggaagttgtgggatac
ccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctcc
accgctatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtc
cagtggaacgacctggactacatggactcccggagggacttcacgttcaacaaggatggc
ttccgggacttcccggccatggtgcaggagctgcaccagggcgggcggcgctacatgatg
atcgtggatcctgccatcagcagctcgggccctgccgggagctacaggccctacgacgag
ggtctgcggaggggggttttcatcaccaacgagaccggccagccgctgattgggaaggta
tggcccgggtccactgccttccccgacttcaccaaccccacagccctggcctggtgggag
gacatggtggctgagttccatgagcaggtgcccttcgacggcatgtggattgacatgaac
gagccttccaacttcatcaggggctctgaggatggctgccccaacaatgagctggagaac
ccaccctacgtgcctggggtggttggggggaccctccaggcggccaccatctgtgcctcc
agccaccagtttctctccacacactacaacctgcacaacctctacggcctgaccgaagcc
atcgcctcccacagggcgctggtgaaggctcgggggacacgcccatttgtgatctcccgc
tcgacctttgctggccacggccgatacgccggccactggacaggggacgtgtggagctcc
tgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctgggggtgcct
ctggtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgc
tggacccagctgggggccttctaccccttcatgcggaaccacaacggcctgcttaatctg
ccccaggagccgtacagcttcagcaagccggcccagcaggccatgaggaaggccctcacc
ctgcgctacgcactcctcccccacctctacacgctgttccaccaggcccacgtcgccggg
gagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtg
gaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccaggccgggaag
gccgaagtgactggctacttccccttgggcacatggtacgacctgcagacggtgccaata
gaggcccttggcagcctcccacccccacctgcagctccccgtgagccagccatccacagc
gaggggcagtgggtgacgctgccggcccccctggacacaatcaacgtccacctccgggct
gggtacatcatccccctgcagggccctggcctcacaaccacagagtcccgccagcagccc
atggccctggctgtggccctgaccaagggtggggaggcccgaggggagctgttctgggac
gatggagagagcctggaagtgctggaacgaggggcctacacacaggtcatcttcctggcc
aggaataacacaatcatgaatgagctggtacatgtgaccagtgagggagctggcctgcag
ctgcagaaggtgactgtcctgggcgtggccacggcgccccagcaggtcctctccaacggc
gtccctgtctccaacttcacctacagccccgacaccaaggttctggacatccatgtctcg
ctgttgatgggagagcagtttctcatcagctggtcttag

DBGET integrated database retrieval system