KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101141362Help
Entry
101141362         CDS       T02442                                 

Gene name
GSTZ1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00350  Tyrosine metabolism
ggo01100  Metabolic pathways
Module
ggo_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101141362 (GSTZ1)
Enzymes [BR:ggo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     101141362 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 101141362
NCBI-ProteinID: XP_004055544
Ensembl: ENSGGOG00000006215
UniProt: G3S5A6
LinkDB All DBs
Position
14
AA seq 216 aa AA seqDB search
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVP
TLKIDGITIHQSLAIIEYLEETRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSILK
QVGEEIQLTWAQNAITSGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDL
TLYPTISSISKRLLVLEAFQVSHPCRQPDTPTELRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggggaagcccatcctctattcctatttccgaagctcctgctcatggagagtt
cgaattgctctggccttgaaaggcatcgactacgagacggtgcccatcaatctcataaag
gatgggggccaacagttttctaaggacttccaggcactgaatcctatgaagcaggtgcca
accctgaagattgatggaatcaccattcaccagtcactggccatcattgagtatctagag
gagacgcgtcccactccgcgacttctgcctcaggacccaaagaagagggccagcgtgcgt
atgatttctgacctcatcgctggtggcatccagcccctgcagaacctgtccatcctgaag
caagtgggagaggagatccagctgacctgggcccagaacgccatcacttctggctttaac
gccctggagcagatcctacagagcacagcgggcatatactgtgtaggagacgaggtgacc
atggctgatctgtgcttggtgcctcaggtggcaaatgctgaaagattcaaggtggatctc
accctctaccctaccatcagctccatcagcaagaggctgctggtcttggaggccttccag
gtgtctcacccctgccggcagccagatacacccactgagctgagggcctag

DBGET integrated database retrieval system