KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101141671Help
Entry
101141671         CDS       T02442                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00250  Alanine, aspartate and glutamate metabolism
ggo00410  beta-Alanine metabolism
ggo00430  Taurine and hypotaurine metabolism
ggo00650  Butanoate metabolism
ggo01100  Metabolic pathways
ggo04727  GABAergic synapse
ggo04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101141671 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101141671 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101141671 (GAD2)
   00430 Taurine and hypotaurine metabolism
    101141671 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    101141671 (GAD2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    101141671 (GAD2)
Enzymes [BR:ggo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101141671 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 101141671
NCBI-ProteinID: XP_004049230
Ensembl: ENSGGOG00000006775
UniProt: G3SJS2
LinkDB All DBs
Position
10
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SQPPRAAARKAACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMMIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccgggctctggcttttggtctttcgggtcggaagatggctctggggattcc
gagaatcccggcacagcgcgagcctggtgccaagtggctcagaagttcacgggcggcatc
ggaaacaaactgtgcgccctgctctacggagacgccgagaagccggcggagagcggcggg
agccaacccccgcgggccgccgcccggaaggccgcctgcgcctgcgaccagaagccctgc
agctgctccaaagtggatgtcaactacgcgtttctccatgcaacagacctgctgccggcg
tgtgatggagaaaggcccactttggcgtttctgcaggatgttatgaacattttacttcag
tatgtggtgaaaagtttcgatagatcaaccaaagtgattgatttccattaccctaatgag
cttctccaagaatataattgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacaggacatcctagatacttcaat
caactttccactggattggatatggttggattagcagcagactggctgacatcaacagca
aatactaacatgttcacctatgaaattgctccagtatttgtgcttttggaatatgtcaca
ctaaagaaaatgagagaaatcattggctggccagggggctctggcgatgggatattttct
cccggtggcgccatatctaacatgtatgccatgatgatcgcacgctttaagatgttcccg
gaagtcaaggagaaaggaatggctgctgttcccaggctcattgccttcacatctgagcat
agtcatttttctctcaaaaagggagctgcagccttagggattggaacagacagcgtgatt
ctgattaaatgtgatgagagagggaaaatgattccatctgatcttgaaagaaggattctt
gaagccaaacagaaagggtttgttcctttcctcgtgagtgccacagctggaaccactgtg
tatggagcatttgaccccctcttagctgtcgctgacatttgcaaaaagtataagatctgg
atgcatgtggatgcagcttggggtgggggattactgatgtcccgaaaacacaagtggaaa
ctgagtggcgtggagagggccaactctgtgacgtggaatccacacaagatgatgggagtc
cctttgcagtgctctgctctcctggttagagaagagggattgatgcagaattgcaaccaa
atgcatgcctcctacctctttcagcaagataaacattatgacctgtcctatgacactgga
gacaaggccttacagtgcggacgccacgttgatgtttttaaactatggctgatgtggagg
gcaaaggggactaccgggtttgaagcgcatgttgataaatgtttggagttggcagagtat
ttatacaacatcataaaaaaccgagaaggatatgagatggtgtttgatgggaagcctcag
cacacaaatgtctgcttctggtacattcctccaagcttgcgtactctggaagacaatgaa
gagagaatgagtcgcctctcgaaggtggctccagtgattaaagccagaatgatggagtat
ggaaccacaatggtcagctaccaacccttgggagacaaggtcaatttcttccgcatggtc
atctcaaacccagcagcaactcaccaagacattgacttcctgattgaagaaatagaacgc
cttggacaagatttataa

DBGET integrated database retrieval system