KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101141713Help
Entry
101141713         CDS       T02442                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101141713 (SETDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ggo03036]
    101141713 (SETDB2)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101141713 (SETDB2)
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101141713 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101141713 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD
Motif
Other DBs
NCBI-GeneID: 101141713
NCBI-ProteinID: XP_018895328
Ensembl: ENSGGOG00000016016
LinkDB All DBs
Position
13
AA seq 741 aa AA seqDB search
MPASRLRVTPLAQLECARQAESASSQSEGGALGRHCGASGDAKTFWMELEDDGKVDFIFE
QVQNVLQSLKQKIKDGSATNKEYVQAMILVNEATIINSSTSIKDHMPVTQKEQENKSNAF
PSTSCENSFPEDCTFLTTENKEILSLEDKVVDFREKDSSSNLSYQSHDCSGACLMKMPLN
LKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYKTPCGRSLRNVEEVFRYLLETECNFLF
TDNFSFNTYVQLARNYPKQKEVVSDVDISNGVESVPISFCNEIDSRKLPQFKYRKTVWPR
AYNLTNFSSMFTDSCDCSEGCIDITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQI
PTGIYECSLLCKCNRQLCQNRVVQHGPQVRLQVFKTEQKGWGVRCLDDIDRGTFVCIYSG
RLLSRANTEKSYGIDENGRDENTMKNIFSKKRKLEVACSDCEVEVLPLGLETHPRTAKTE
KCPPKFSNNPKELTMETKYDNISRIQYHSVIRDPESKTAIFQHNGKKMEFVSSESVTPED
NDGFKPPREHLNSKTKGAQKDSSSNHVDEFEDNLLIESDVIDITKYREETPPRSRCNQAT
TLDNQNIKKAIEVQIQKPQEGRSTACQRQQVFCDEELLSETKSTSSDSLTKFNKGNVFLL
DATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAG
TVPEKEIFCQCGVNKCRKKIL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctctcgactacgagtaactccattggctcagctagagtgcgcgagacaagcc
gagagcgctagcagtcaatcggaaggcggcgcgctcgggcgccactgcggtgccagcggc
gatgcaaaaactttctggatggagctagaagatgatggaaaagtggacttcatttttgaa
caagtacaaaatgtgctgcagtcactgaaacaaaagatcaaagatgggtctgccaccaat
aaagaatacgtccaagcaatgattctagtgaatgaagcaactataattaacagttcaaca
tcaataaaggatcatatgcctgtgactcagaaggaacaggaaaacaaatccaatgcattt
ccctctacatcatgtgaaaactcctttccagaagactgtacatttctaacaacagaaaat
aaggaaattctgtctcttgaagataaagttgtagactttagagaaaaagactcatcttcg
aatttatcttaccaaagtcatgactgctctggtgcttgtctgatgaaaatgccactgaac
ttgaagggagaaaaccctctgcagctgccaatcaaatgtcacttccaaagacgacatgca
aagacaaactctcattcttcagcactccacgtgagttataaaaccccttgtggaaggagt
ctacgaaacgtggaggaagtttttcgttacctgcttgagacagagtgtaactttttattt
acagataacttttctttcaatacctatgttcagttggctcggaattacccaaagcaaaaa
gaagttgtttctgatgtggatattagcaatggagtggaatcagtgcccatttctttctgt
aatgaaattgacagtagaaagctcccacagtttaagtacagaaagactgtgtggcctcga
gcatataatctaaccaacttttccagcatgtttactgattcctgtgactgctctgagggc
tgcatagacataacaaaatgtgcatgtcttcaactgacagcaaggaatgccaaaacttcc
cccttgtcaagtgacaaaataaccactggatataaatataaaagactacagagacagatc
cctactggcatttatgaatgcagccttttgtgcaaatgtaatcgacaattgtgtcaaaac
cgagttgtccaacatggtcctcaagtgaggttacaggtgttcaaaactgagcagaaggga
tggggtgtacgctgtctagatgacattgacagagggacatttgtttgcatttattcagga
agattactaagcagagctaacactgaaaaatcttatggcattgatgaaaacgggagagat
gagaatactatgaaaaatatattttcaaaaaagaggaaattagaagttgcatgttcagat
tgtgaagttgaagttctcccattaggattggaaacacatcctagaactgctaaaactgag
aaatgtccaccaaagttcagtaataatcccaaggagcttactatggaaacgaaatatgat
aatatttcaagaattcaatatcattcagttattagagatcctgaatccaagacagccatt
tttcaacacaatgggaaaaaaatggaatttgtttcctcggagtctgtcactccagaagat
aatgatggatttaaaccaccccgagagcatctgaactctaaaaccaagggagcacaaaag
gactcaagttcaaaccatgttgatgagtttgaagataatctgctgattgaatcagatgtg
atagatataactaaatatagagaagaaactccaccaaggagcagatgtaaccaggcgacc
acattggataatcagaatattaaaaaggcaattgaggttcaaattcagaaaccccaagag
ggacgatctacagcatgtcaaagacagcaggtcttttgtgatgaagagttgctaagtgaa
accaagagtacttcatctgattctctaacaaagttcaataaagggaatgtgtttttattg
gatgccacaaaagaaggaaatgtcggccgcttccttaatcatagttgttgcccaaatctc
ttggtacagaatgtttttgtagaaacacacaacaggaattttccattggtggcattcttc
accaacaggtatgtgaaagcaagaacagagctaacatgggattatggctatgaagctggg
actgtgcctgagaaggaaatcttctgccaatgtggggttaataaatgtagaaaaaaaata
ttataa

DBGET integrated database retrieval system