KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101141874Help
Entry
101141874         CDS       T02442                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00020  Citrate cycle (TCA cycle)
ggo00190  Oxidative phosphorylation
ggo01100  Metabolic pathways
ggo01200  Carbon metabolism
ggo04714  Thermogenesis
ggo04932  Non-alcoholic fatty liver disease (NAFLD)
ggo05010  Alzheimer disease
ggo05012  Parkinson disease
ggo05016  Huntington disease
Module
ggo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ggo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ggo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101141874 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101141874 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101141874 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101141874 (SDHA)
   05012 Parkinson disease
    101141874 (SDHA)
   05016 Huntington disease
    101141874 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101141874 (SDHA)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101141874 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 FAD_binding_3 GIDA Thi4 NAD_binding_8 HI0933_like
Motif
Other DBs
NCBI-GeneID: 101141874
NCBI-ProteinID: XP_018868556
LinkDB All DBs
Position
17
AA seq 146 aa AA seqDB search
MSGVRGLSRLLTARRLALAKAWPTVLQTGTRGFQFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQVRERCPTVLPHRAGPV
QPRTFYLGSPLPPPPAPATWPLAVPY
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccggggcctgtcgcggctgctgaccgctcggcgcctggcgctggccaag
gcgtggccaacagtgttgcaaacaggaacccgaggttttcagttcactgttgatgggaac
aagagggcatctgctaaagtttcagattccatttctgctcagtatccagtagtggatcat
gaatttgatgcagtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaagcagggtttaatacagcatgtgttaccaagctgtttcctaccaggtcacacact
gttgcagcgcaggtaagagaaaggtgccccactgtgctcccacaccgtgcaggtcccgtg
cagcctcgcactttctacctgggcagccccctgcctcctccccctgctccagccacatgg
cctcttgctgtgccttac

DBGET integrated database retrieval system