KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101142374
Entry
101142374         CDS       T02442                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04015  Rap1 signaling pathway
ggo04218  Cellular senescence
ggo04380  Osteoclast differentiation
ggo04620  Toll-like receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04935  Growth hormone synthesis, secretion and action
ggo05014  Amyotrophic lateral sclerosis
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05132  Salmonella infection
ggo05135  Yersinia infection
ggo05145  Toxoplasmosis
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101142374 (MAP2K6)
   04015 Rap1 signaling pathway
    101142374 (MAP2K6)
   04668 TNF signaling pathway
    101142374 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101142374 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101142374 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    101142374 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101142374 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    101142374 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101142374 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101142374 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101142374 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101142374 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    101142374 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101142374 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101142374 (MAP2K6)
   05135 Yersinia infection
    101142374 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101142374 (MAP2K6)
   05161 Hepatitis B
    101142374 (MAP2K6)
   05163 Human cytomegalovirus infection
    101142374 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101142374 (MAP2K6)
   05169 Epstein-Barr virus infection
    101142374 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101142374 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101142374 (MAP2K6)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101142374 (MAP2K6)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: STE group
  STE7 family
   101142374 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal DUF4344 Choline_kinase APH
Other DBs
NCBI-GeneID: 101142374
NCBI-ProteinID: XP_018883941
Ensembl: ENSGGOG00000006086
UniProt: A0A2I2ZIV3
LinkDB
Position
5
AA seq 278 aa
MELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFY
GALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVI
HRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSV
KSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLK
KNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
NT seq 837 nt   +upstreamnt  +downstreamnt
atggaactgggacgaggtgcgtacggggtggtggagaagatgcggcacgtgcccagcggg
cagatcatggcagtgaagcggatccgagccacggtaaatagccaggaacagaaacggcta
ctgatggatttggatatttccatgaggacggtggactgtccattcactgtcaccttttat
ggcgcactgtttcgggagggtgatgtgtggatctgcatggagctcatggatacatcacta
gataaattctacaaacaagttattgataaaggccagacaattccagaggacatcttaggg
aaaatagcagtttctattgtaaaagcattagaacatttacatagtaagctgtctgtcatt
cacagagacgtcaagccttctaatgtactcatcaatgctctcggtcaagtgaagatgtgc
gattttggaatcagtggctacttggtggactctgttgctaaaacaattgatgcaggttgc
aaaccatacatggcccctgaaagaataaacccagagctcaaccagaagggatacagtgtg
aagtctgacatttggagtctgggcatcacgatgattgagttggccatccttcgatttccc
tatgattcatggggaactccatttcagcagctcaaacaggtggtagaggagccatcgcca
caactcccagcagacaagttctctgcagagtttgttgactttacctcacagtgcttaaag
aagaattccaaagaacggcctacatacccagagctaatgcaacatccatttttcacccta
catgaatccaaaggaacagatgtggcatcttttgtaaaactgattcttggagactaa

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145420
Entry
101145420         CDS       T02442                                 

Gene name
MAP2K3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3 isoform X1
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04015  Rap1 signaling pathway
ggo04218  Cellular senescence
ggo04620  Toll-like receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04714  Thermogenesis
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04935  Growth hormone synthesis, secretion and action
ggo05014  Amyotrophic lateral sclerosis
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05132  Salmonella infection
ggo05135  Yersinia infection
ggo05145  Toxoplasmosis
ggo05161  Hepatitis B
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101145420 (MAP2K3)
   04015 Rap1 signaling pathway
    101145420 (MAP2K3)
   04668 TNF signaling pathway
    101145420 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101145420 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101145420 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    101145420 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101145420 (MAP2K3)
   04935 Growth hormone synthesis, secretion and action
    101145420 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101145420 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101145420 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101145420 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101145420 (MAP2K3)
   05022 Pathways of neurodegeneration - multiple diseases
    101145420 (MAP2K3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101145420 (MAP2K3)
   05135 Yersinia infection
    101145420 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101145420 (MAP2K3)
   05161 Hepatitis B
    101145420 (MAP2K3)
   05169 Epstein-Barr virus infection
    101145420 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101145420 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101145420 (MAP2K3)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101145420 (MAP2K3)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: STE group
  STE7 family
   101145420 (MAP2K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase RIO1 DUF4344
Other DBs
NCBI-GeneID: 101145420
NCBI-ProteinID: XP_004042142
Ensembl: ENSGGOG00000000670
UniProt: G3QEG5
LinkDB
Position
5
AA seq 347 aa
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagtcgcccgcctcgagccagcccgccagcatgccccagtccaaaggaaaatccaag
aggaagaaggatctacggatatcctgcatgtccaagccacccgcacccaaccccacaccc
ccccggaacctggactcccggaccttcatcaccattggagacagaaactttgaggtggag
gctgatgacttggtgaccatctcagaactgggccgtggagcctatggggtggtagagaag
gtgcggcacgcccagagcggcaccatcatggccgtgaagcggatccgggccaccgtgaac
tcacaggagcagaagcggctgctcatggacctggacatcaacatgcgcacggtcgactgc
ttctacactgtcaccttctacggggcactatttagagagggagacgtctggatctgcatg
gagctcatggacacatctttggacaagttctaccggaaggtgctggataaaaacatgaca
attccagaggacatccttggggagattgctgtgtctatcgtgcgggccctggagcatctg
cacagcaagctgtcggtgatccacagagatgtgaagccctccaatgtccttatcaacaag
gagggccatgtgaagatgtgtgactttggcatcagtggctacttggtggactctgtggcc
aagacgatggatgccggctgcaagccctacatggcccctgagaggatcaacccagagctg
aaccagaagggctacaatgtcaagtccgatgtctggagcctgggcatcaccatgattgag
atggccatcctgcggttcccttacgagtcctgggggaccccgttccagcagctgaagcag
gtggtggaggagccgtccccccagctcccagccgaccgtttctcccccgagtttgtggac
ttcactgctcagtgcctgaggaagaaccccgcagagcgtatgagctacctggagctgatg
gagcaccccttcttcaccttgcacaaaaccaagaagacggacattgctgccttcgtgaag
gagatcctgggagaagactcatag

DBGET integrated database retrieval system