KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101142469
Entry
101142469         CDS       T02442                                 

Gene name
MMP14
Definition
(RefSeq) matrix metalloproteinase-14
  KO
K07763  matrix metalloproteinase-14 (membrane-inserted) [EC:3.4.24.80]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04668  TNF signaling pathway
ggo04912  GnRH signaling pathway
ggo04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101142469 (MMP14)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101142469 (MMP14)
   04928 Parathyroid hormone synthesis, secretion and action
    101142469 (MMP14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ggo01002]
    101142469 (MMP14)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.80  membrane-type matrix metalloproteinase-1
     101142469 (MMP14)
Peptidases and inhibitors [BR:ggo01002]
 Metallo peptidases
  Family M10
   101142469 (MMP14)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M54 Metallopep DUF4953 HTH_17 Reprolysin_3 Peptidase_M66 Reprolysin_5
Other DBs
NCBI-GeneID: 101142469
NCBI-ProteinID: XP_004055023
Ensembl: ENSGGOG00000001650
UniProt: A0A2I2ZNE4
LinkDB
Position
14
AA seq 582 aa
MSPAPRPSRCLLLPLLTLGTALACLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgtctcccgccccaagaccctcccgttgtctcctgctccccttgctcacgctcggcacc
gcgctcgcctgcctcggctcggcccaaagcagcagcttcagccccgaagcctggctacag
caatatggctacctgcctcccggggacctacgtacccacacacagcgctcaccccagtca
ctctcagcggccatcgctgccatgcagaagttttacggcttgcaagtaacaggcaaagct
gatgcagacaccatgaaggccatgaggcgcccccgatgtggtgttccagacaagtttggg
gctgagatcaaggccaatgttcgaaggaagcgctacgccatccagggtctcaaatggcaa
cataatgaaatcactttctgcatccagaattacacccccaaggtgggcgagtatgccaca
tacgaggccattcgcaaggcgttccgcgtgtgggagagtgccacaccactgcgcttccgc
gaggtgccctatgcctacatccgtgagggccatgagaagcaggccgacatcatgatcttc
tttgccgagggcttccatggcgacagcacgcccttcgatggtgagggcggcttcctggcc
catgcctacttcccaggccccaacattggaggggacacccactttgactctgccgagcct
tggactgtcaggaatgaggatctgaatggaaatgacatcttcctggtggctgtgcatgag
ctgggccatgctctggggctcgagcattccagtgacccctcggccatcatggcacccttt
taccagtggatggacacggagaactttgtgctgcctgatgatgaccgccggggcatccag
caactttatgggggtgagtcagggttccccaccaagatgccccctcaacccaggactacc
tcccggccttctgttcctgataaacccaaaaaccccacctatgggcccaacatctgtgac
gggaactttgacaccgtggccatgctccgaggggagatgtttgttttcaaggagcgctgg
ttctggcgggtgaggaataaccaagtgatggatggatacccaatgcccattggccagttc
tggcggggcctgcctgcgtccatcaacactgcctacgagaggaaggatggcaaattcgtc
ttcttcaaaggagacaagcattgggtgtttgatgaggcgtccctggaacccggctacccc
aagcacattaaggagctgggccgagggctgcctaccgacaagattgatgctgctctcttc
tggatgcccaatggaaagacctacttcttccgtggaaacaagtactaccgtttcaacgaa
gagctcagggcagtggatagcgagtaccccaagaacatcaaagtctgggaagggatccct
gagtctcccagagggtcattcatgggcagcgatgaagtcttcacttacttctacaagggg
aacaaatactggaaattcaacaaccagaagctgaaggtagaaccgggctaccccaagtca
gccctgagggactggatgggctgcccatcgggaggccggccggatgaggggactgaggag
gagacggaggtgatcatcattgaggtggatgaggagggcggcggggcggtgagcgcggct
gccgtggtgctgcccgtgctgctgctgctcctggtgctggcggtgggccttgcagtcttc
ttcttcagacgccatgggacccccaggcgactgctctactgccagcgttccctgctggac
aaggtctga

DBGET integrated database retrieval system