KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101143526
Entry
101143526         CDS       T02442                                 

Gene name
FSHB
Definition
(RefSeq) follitropin subunit beta
  KO
K05250  follitropin subunit beta
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04024  cAMP signaling pathway
ggo04080  Neuroactive ligand-receptor interaction
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101143526 (FSHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101143526 (FSHB)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101143526 (FSHB)
   04913 Ovarian steroidogenesis
    101143526 (FSHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 101143526
NCBI-ProteinID: XP_004050915
Ensembl: ENSGGOG00000009510
UniProt: A0A2K5TIY3
LinkDB
Position
11
AA seq 129 aa
MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP
ARPNIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPS
YCSFGEMKE
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaagacactccagtttttcttccttttctgttgctggaaagcaatctgctgcaatagc
tgtgagctgaccaacatcaccattgcaatagagaaagaagaatgtcgtttctgcataagc
atcaacaccacttggtgtgctggctactgctacaccagggatctggtgtacaaggaccca
gccaggcccaacatccagaaaacatgtaccttcaaggaactggtatatgaaacagtgaga
gtgcccggctgtgctcaccatgcagattccttgtatacatacccagtggccacccagtgt
cactgtggcaagtgtgacagcgacagcactgactgtaccgtgcgaggcctggggcccagc
tactgctcctttggtgaaatgaaagaataa

DBGET integrated database retrieval system