KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101144031
Entry
101144031         CDS       T02442                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X4
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00230  Purine metabolism
ggo01100  Metabolic pathways
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04114  Oocyte meiosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04727  GABAergic synapse
ggo04740  Olfactory transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04962  Vasopressin-regulated water reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05032  Morphine addiction
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101144031 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101144031 (ADCY3)
   04371 Apelin signaling pathway
    101144031 (ADCY3)
   04020 Calcium signaling pathway
    101144031 (ADCY3)
   04072 Phospholipase D signaling pathway
    101144031 (ADCY3)
   04024 cAMP signaling pathway
    101144031 (ADCY3)
   04022 cGMP-PKG signaling pathway
    101144031 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101144031 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101144031 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101144031 (ADCY3)
   04062 Chemokine signaling pathway
    101144031 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    101144031 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    101144031 (ADCY3)
   04912 GnRH signaling pathway
    101144031 (ADCY3)
   04913 Ovarian steroidogenesis
    101144031 (ADCY3)
   04915 Estrogen signaling pathway
    101144031 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    101144031 (ADCY3)
   04921 Oxytocin signaling pathway
    101144031 (ADCY3)
   04926 Relaxin signaling pathway
    101144031 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    101144031 (ADCY3)
   04918 Thyroid hormone synthesis
    101144031 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    101144031 (ADCY3)
   04916 Melanogenesis
    101144031 (ADCY3)
   04925 Aldosterone synthesis and secretion
    101144031 (ADCY3)
   04927 Cortisol synthesis and secretion
    101144031 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101144031 (ADCY3)
   04270 Vascular smooth muscle contraction
    101144031 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    101144031 (ADCY3)
   04971 Gastric acid secretion
    101144031 (ADCY3)
   04972 Pancreatic secretion
    101144031 (ADCY3)
   04976 Bile secretion
    101144031 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101144031 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101144031 (ADCY3)
   04727 GABAergic synapse
    101144031 (ADCY3)
   04725 Cholinergic synapse
    101144031 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    101144031 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    101144031 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    101144031 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    101144031 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    101144031 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101144031 (ADCY3)
   04714 Thermogenesis
    101144031 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101144031 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    101144031 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101144031 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101144031 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101144031 (ADCY3)
   05163 Human cytomegalovirus infection
    101144031 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101144031 (ADCY3)
Enzymes [BR:ggo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101144031 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA RAP1 OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 101144031
NCBI-ProteinID: XP_004028977
Ensembl: ENSGGOG00000004078
LinkDB
Position
2A
AA seq 1144 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGIGLVLDII
LFVLCKKGLLPDRVTRRVVPYVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPGNATAGMETEGGCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVATINLYAWRPVFDEYDHKRFREHDLPMVALEQMQGFNPGLNGTDRLPLVPSKY
SMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQV
VDNS
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgagcccgaatactcggccgagtactcagccgagtac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggctcctgcctgtgcctgcctcgcttcatgcggctgactttcgtgccggag
tccttggagaacctctaccagacctacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgcagccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctagctcccctcgccgtggctggaattggactggtgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccgcagagtggtgccc
tacgtgctgtggctgctcataaccgcccagatcttctcctacctgggcctgaacttcgcg
cgtgcccacgcggctagtgacacggtgggctggcaggtcttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtgatcatctccgtggtctcctgtgtggtg
cacacgttggtcctgggggtcaccgtggcccagcagcagcaggaggagctcaaggggatg
cagctgctgcgggagatcctggccaacgtcttcctctacctgtgcgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaagacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgtcacgagaacgtcagcatc
ctctttgccgacatcgtgggctttacccagctgtcttctgcctgcagtgcccaggagctt
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcggcttgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctggccatggtggaggccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgatgtgtggtcgactgatgtcact
gtagccaacaagatggaggccggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggagccaggcgatgggggcagccgctgtgat
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagccacccagaatggcctcaatggctcggccctgcccaatggagcgccagcttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaatgggagtgcccacagc
agcgggtccacgtcggagaagcctgaggagcaggatgcccaggccgacaacccctcattc
cccaacccacgccggaggctgcgcctgcaggacctggctgaccgagtggtggatgcctct
gaagatgagcacgagctcaaccagctgctcaacgaggccctgcttgagcgagagtccgcc
caagtagtaaagaagagaaacaccttcctcttgtccatgcggttcatggaccctgagatg
gaaacccgctattcggtggagaaggagaagcagagtggggctgccttcagctgctcctgc
gtcgtcctgctctgcacggctctggtcgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcatggtgggggagattctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcaacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatcctggtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacgggacccggcaacgcaacggcaggg
atggagacggagggtggctgcctggagaaccccaagtattacaactatgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatg
ctgctcgtcgcaggcgccgtggccaccatcaacctctatgcctggcgccccgtctttgat
gaatacgaccacaagcgttttcgggagcacgacttacctatggtggccttagagcagatg
caaggattcaaccctgggctcaatggcactgacaggctgcccctggtgccttccaagtac
tctatgacggtgatggtgttcctcatgatgctcagcttctactacttctcccgccacgta
gaaaaactggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaacgt
gtctacgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcacgtg
gcacgccatttcctggggtccaagaagagagatgaggagctgtatagccagacgtatgat
gagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggagagc
atcaacaatggtggtattgagtgtctgcgtttcctcaatgaaatcatctcggattttgac
tctctcctggacaatcccaagttccgagtgatcaccaagatcaaaaccattggcagcacg
tatatggcggcttcaggagtcacccccgatgtcaacaccaatggctttgccagctccaac
aaggaagacaagtccgagagagagcgctggcagcacctggctgacctggccgacttcgcg
ctggccatgaaggatacgctcaccaacatcaacaaccagtccttcaataacttcatgctg
cgcataggcatgaacaaaggcggggttctggctggggtcattggagcccggaaaccacac
tacgacatctggggcaatacagtcaatgtagccagcaggatggagtccacgggggtcatg
ggcaacattcaggtggtagaagaaacccaagtcatcctccgagagtacggcttccgcttt
gtgaggcgaggccccatctttgtgaaggggaagggggagctgctgaccttcttcttgaag
gggcgggataagctagccaccttccccaatggcccctctgtcacactgccccaccaggtg
gtggacaactcctga

DBGET integrated database retrieval system