KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145449Help
Entry
101145449         CDS       T02442                                 

Definition
(RefSeq) putative trypsin-6
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04080  Neuroactive ligand-receptor interaction
ggo04972  Pancreatic secretion
ggo04974  Protein digestion and absorption
ggo05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101145449
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    101145449
   04974 Protein digestion and absorption
    101145449
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    101145449
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ggo01002]
    101145449
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101145449
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101145449
Peptidases [BR:ggo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101145449
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101145449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 101145449
NCBI-ProteinID: XP_004046416
Ensembl: ENSGGOG00000008440
LinkDB All DBs
Position
7
AA seq 247 aa AA seqDB search
MNPLLILAFVGAAVAVPFDDDDKIVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVS
AGHCYKPHIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNRITLNNDIMLIKLSTPAVLN
AHVSTISLPTAPPAAGTECLISGWGNTLSSGADYPDELQCLDAPVLTQAKCKASYPLKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKRRPGVYTKVYNYVDWIK
DTIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttgcctttgtgggagctgctgttgctgtcccctttgatgat
gatgacaagattgttgggggctacacctgtgaggagaattctgtcccctaccaggtgtcc
ttgaattctggctcccacttctgcggtggctccctcatcagcgaacagtgggtggtatca
gcaggtcactgctacaagccccacatccaggtgagactgggagagcacaatatcgaagtc
ctggaggggaatgagcagttcatcaatgcagccaagatcatccgccaccccaaatacaac
aggattactctgaacaatgacatcatgctgatcaagctctccacacctgccgtcctcaat
gcccatgtgtccaccatctctctgcccactgcccctccagctgctggcaccgagtgcctt
atctccggctggggcaataccctgagctctggggccgactacccagatgagctgcagtgc
ctggacgctcctgtgctgacccaggctaagtgtaaagcctcctaccctttaaagattacc
agcaacatgttctgtgtgggcttccttgagggaggcaaggattcctgccagggtgactct
ggtggccctgtggtctgcaatggacagcttcaaggaattgtctcctggggctatggctgt
gcccagaagagaaggcctggagtctataccaaggtctacaactatgtggactggattaag
gacaccatagctgccaacagctaa

DBGET integrated database retrieval system