KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145729
Entry
101145729         CDS       T02442                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04024  cAMP signaling pathway
ggo04137  Mitophagy - animal
ggo04210  Apoptosis
ggo04310  Wnt signaling pathway
ggo04380  Osteoclast differentiation
ggo04510  Focal adhesion
ggo04530  Tight junction
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04662  B cell receptor signaling pathway
ggo04668  TNF signaling pathway
ggo04722  Neurotrophin signaling pathway
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04926  Relaxin signaling pathway
ggo04932  Non-alcoholic fatty liver disease
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo05030  Cocaine addiction
ggo05031  Amphetamine addiction
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05135  Yersinia infection
ggo05140  Leishmaniasis
ggo05142  Chagas disease
ggo05161  Hepatitis B
ggo05162  Measles
ggo05166  Human T-cell leukemia virus 1 infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05171  Coronavirus disease - COVID-19
ggo05200  Pathways in cancer
ggo05203  Viral carcinogenesis
ggo05210  Colorectal cancer
ggo05211  Renal cell carcinoma
ggo05224  Breast cancer
ggo05231  Choline metabolism in cancer
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ggo05321  Inflammatory bowel disease
ggo05323  Rheumatoid arthritis
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101145729 (JUN)
   04012 ErbB signaling pathway
    101145729 (JUN)
   04310 Wnt signaling pathway
    101145729 (JUN)
   04668 TNF signaling pathway
    101145729 (JUN)
   04024 cAMP signaling pathway
    101145729 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101145729 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    101145729 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101145729 (JUN)
   04530 Tight junction
    101145729 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101145729 (JUN)
   04621 NOD-like receptor signaling pathway
    101145729 (JUN)
   04625 C-type lectin receptor signaling pathway
    101145729 (JUN)
   04660 T cell receptor signaling pathway
    101145729 (JUN)
   04658 Th1 and Th2 cell differentiation
    101145729 (JUN)
   04659 Th17 cell differentiation
    101145729 (JUN)
   04657 IL-17 signaling pathway
    101145729 (JUN)
   04662 B cell receptor signaling pathway
    101145729 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101145729 (JUN)
   04915 Estrogen signaling pathway
    101145729 (JUN)
   04921 Oxytocin signaling pathway
    101145729 (JUN)
   04926 Relaxin signaling pathway
    101145729 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101145729 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101145729 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101145729 (JUN)
   05203 Viral carcinogenesis
    101145729 (JUN)
   05231 Choline metabolism in cancer
    101145729 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101145729 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101145729 (JUN)
   05211 Renal cell carcinoma
    101145729 (JUN)
   05224 Breast cancer
    101145729 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101145729 (JUN)
   05321 Inflammatory bowel disease
    101145729 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    101145729 (JUN)
   05031 Amphetamine addiction
    101145729 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101145729 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101145729 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101145729 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101145729 (JUN)
   05135 Yersinia infection
    101145729 (JUN)
   05133 Pertussis
    101145729 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101145729 (JUN)
   05170 Human immunodeficiency virus 1 infection
    101145729 (JUN)
   05161 Hepatitis B
    101145729 (JUN)
   05171 Coronavirus disease - COVID-19
    101145729 (JUN)
   05162 Measles
    101145729 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101145729 (JUN)
   05169 Epstein-Barr virus infection
    101145729 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101145729 (JUN)
   05142 Chagas disease
    101145729 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101145729 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101145729 (JUN)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    101145729 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 TFIIA Fib_alpha DUF3450 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 101145729
NCBI-ProteinID: XP_004025929
LinkDB
Position
1
AA seq 334 aa
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQMPVPHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctcccg
tccgagagcggaccttatggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagatgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcaacggggcg
ggcatggtggctcccgcggtagcctcggtggcagggggcagcggcagcggcggcttcagc
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccaggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagcagccgccgcagccgccgcaccacctgccccagcagatgcccgtg
ccgcacccgcggctgcaggccctgaaggaggagcctcagacagtgcccgagatgcccggc
gagacaccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagagg
aagcgcatgaggaaccgcatcgctgcctccaagtgccgaaaaaggaagctggagagaatc
gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacattttga

DBGET integrated database retrieval system