KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145841
Entry
101145841         CDS       T02442                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01523  Antifolate resistance
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04062  Chemokine signaling pathway
ggo04064  NF-kappa B signaling pathway
ggo04151  PI3K-Akt signaling pathway
ggo04210  Apoptosis
ggo04380  Osteoclast differentiation
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04622  RIG-I-like receptor signaling pathway
ggo04623  Cytosolic DNA-sensing pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04662  B cell receptor signaling pathway
ggo04668  TNF signaling pathway
ggo04920  Adipocytokine signaling pathway
ggo05132  Salmonella infection
ggo05135  Yersinia infection
ggo05142  Chagas disease
ggo05145  Toxoplasmosis
ggo05160  Hepatitis C
ggo05161  Hepatitis B
ggo05162  Measles
ggo05163  Human cytomegalovirus infection
ggo05164  Influenza A
ggo05165  Human papillomavirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05168  Herpes simplex virus 1 infection
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05200  Pathways in cancer
ggo05203  Viral carcinogenesis
ggo05212  Pancreatic cancer
ggo05215  Prostate cancer
ggo05220  Chronic myeloid leukemia
ggo05221  Acute myeloid leukemia
ggo05222  Small cell lung cancer
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ggo05340  Primary immunodeficiency
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101145841 (IKBKG)
   04014 Ras signaling pathway
    101145841 (IKBKG)
   04064 NF-kappa B signaling pathway
    101145841 (IKBKG)
   04668 TNF signaling pathway
    101145841 (IKBKG)
   04151 PI3K-Akt signaling pathway
    101145841 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101145841 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101145841 (IKBKG)
   04621 NOD-like receptor signaling pathway
    101145841 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    101145841 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    101145841 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    101145841 (IKBKG)
   04660 T cell receptor signaling pathway
    101145841 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    101145841 (IKBKG)
   04659 Th17 cell differentiation
    101145841 (IKBKG)
   04657 IL-17 signaling pathway
    101145841 (IKBKG)
   04662 B cell receptor signaling pathway
    101145841 (IKBKG)
   04062 Chemokine signaling pathway
    101145841 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101145841 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101145841 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101145841 (IKBKG)
   05203 Viral carcinogenesis
    101145841 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101145841 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101145841 (IKBKG)
   05221 Acute myeloid leukemia
    101145841 (IKBKG)
   05220 Chronic myeloid leukemia
    101145841 (IKBKG)
   05215 Prostate cancer
    101145841 (IKBKG)
   05222 Small cell lung cancer
    101145841 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    101145841 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101145841 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101145841 (IKBKG)
   05135 Yersinia infection
    101145841 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101145841 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    101145841 (IKBKG)
   05162 Measles
    101145841 (IKBKG)
   05164 Influenza A
    101145841 (IKBKG)
   05161 Hepatitis B
    101145841 (IKBKG)
   05160 Hepatitis C
    101145841 (IKBKG)
   05168 Herpes simplex virus 1 infection
    101145841 (IKBKG)
   05163 Human cytomegalovirus infection
    101145841 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101145841 (IKBKG)
   05169 Epstein-Barr virus infection
    101145841 (IKBKG)
   05165 Human papillomavirus infection
    101145841 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101145841 (IKBKG)
   05142 Chagas disease
    101145841 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101145841 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101145841 (IKBKG)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101145841 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Bacillus_HBL LLC1
Other DBs
NCBI-GeneID: 101145841
NCBI-ProteinID: XP_004065190
Ensembl: ENSGGOG00000004896
UniProt: G3RVA2
LinkDB
Position
X
AA seq 419 aa
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQMLRERCEELLHFQASQREEKEFLMCRFQEARKLVERLSLEKLDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgaataggcacctctggaagagccaactgtgtgagatggtgcagcccagtggtggcccg
gcagcagatcaggacgtactgggcgaagagtctcctctggggaagccagccatgctgcac
ctgccttcagaacagggcgctcctgagaccctccagcgctgcctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgctgcgggagcgctgcgaggagcttctg
catttccaagccagccagagggaggagaaggagttcctcatgtgcagattccaggaggcc
aggaaactggtggagagactcagcctggagaagctcgacctgaagaggcagaaggagcag
gctctgcgggaggtggagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tctgtgaaagcccaggtgacgtccttgctcggggagctgcaggagagccagagtcgcttg
gaggctgccactaaggaatgccaggctctggagggtcgggcccgggcggccagcgagcag
gcgcggcagctggagagtgagcgcgaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagggccagagcgtggaggccgcgctccgcatggagcgccaggccgcc
tcggaggagaagaggaagctggcccagttgcaggtggcctatcaccagctcttccaagaa
tacgacaaccacatcaagagcagcgtggtgggcagtgagcggaagcgaggaatgcagctg
gaagatctcaaacagcagctccagcaggccgaggaggccctggtggccaaacaggaggtg
atcgataagctgaaggaggaggccgagcagcacaagattgtgatggagaccgttccggtg
ctgaaggcccaggcggatatctacaaggcggacttccaggctgagaggcaggcccgggag
aagctggccgagaagaaggagctcctgcaggagcagctggagcagctgcagagggagtac
agcaaactgaaggccagctgtcaggagtcggccaggatcgaggacatgaggaagcggcat
gtcgaggtctcccaggcccccttgccccccgcccctgcctacctctcctctcccctggcc
ctgcccagccagaggaggagcccccccgaggagccacctgacttctgctgtcccaagtgc
cagtatcaggcccctgatatggacaccctgcagatacatgtcatggagtgcattgagtag

DBGET integrated database retrieval system