KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146240Help
Entry
101146240         CDS       T02442                                 

Gene name
ACY1
Definition
(RefSeq) aminoacylase 1
  KO
K14677  aminoacylase [EC:3.5.1.14]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00220  Arginine biosynthesis
ggo01100  Metabolic pathways
ggo01210  2-Oxocarboxylic acid metabolism
ggo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101146240 (ACY1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ggo01002]
    101146240 (ACY1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101146240 (ACY1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.14  N-acyl-aliphatic-L-amino acid amidohydrolase
     101146240 (ACY1)
Peptidases [BR:ggo01002]
 Metallo Peptidases
  Family M20
   101146240 (ACY1)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101146240 (ACY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 101146240
NCBI-ProteinID: XP_004034294
Ensembl: ENSGGOG00000016084
UniProt: A0A2I2ZDU4
LinkDB All DBs
Position
3
AA seq 408 aa AA seqDB search
MTNKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVV
TVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQ
YLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANP
TDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVSSILAFREKEWQRLQSN
PHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEG
VTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPAL
GFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaagggtcccgaggaggagcacccatcggtgacgctcttccgccagtacctg
cgcatccgcaccgtccagcccaagcctgactatggagctgctgtggctttctttgaggag
acagcccgccagctgggcctgggctgtcagaaagtggaggtggcacctggctacgtggtg
accgtgttgacctggccaggcaccaaccctacactctcctccatcttgctcaactcccac
acggatgtggtacctgtcttcaaggaacattggagtcacgacccctttgaggccttcaag
gattctgagggctacatctatgccaggggtgcccaggacatgaagtgcgtcagcatccag
tacctggaagctgtgaggaggctgaaggtggagggccaccggttccccagaaccatccac
atgacctttgtgcctgatgaggaggttgggggtcaccaaggcatggagctgttcgtgcag
cggcctgagttccacgccctgagggcaggctttgccctggatgagggcatagccaatccc
actgatgccttcactgtcttttatagtgagcggagtccctggtgggtgcgggttaccagc
actgggaggccaggccatgcctcgcgcttcatggaggacacagcagcagagaagctgcac
aaggttgtgagctccatcctggcattccgggagaaggaatggcagaggctgcagtcaaac
ccccacctgaaagaggggtctgtgacctccgtgaacctgactaagctagagggtggcgtg
gcctataacgtgatacctgccaccatgagcgccagctttgacttccgtgtggcaccggat
gtggacttcaaggcttttgaggagcagctgcagagctggtgccaggcagctggcgagggg
gtcaccttagagtttgctcagaagtggatgcacccccaagtgacacctactgatgactca
aacccttggtgggcagcttttagccgggtctgcaaggatatgaacctcactctggagcct
gagatcatgcctgctgccactgacaaccgctatatccgcgcggtgggggtcccagctcta
ggcttttcacccatgaaccgcacacctgtgctgctgcacgaccacgatgaacggctgcat
gaggctgtgttcctccgtggggtggacatatatacacgcctgctgcctgcccttgccagt
gtgcctgccctgcccagtgacagctga

DBGET integrated database retrieval system