KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146681Help
Entry
101146681         CDS       T02442                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00590  Arachidonic acid metabolism
ggo01100  Metabolic pathways
ggo04064  NF-kappa B signaling pathway
ggo04370  VEGF signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04668  TNF signaling pathway
ggo04723  Retrograde endocannabinoid signaling
ggo04726  Serotonergic synapse
ggo04913  Ovarian steroidogenesis
ggo04921  Oxytocin signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo05140  Leishmaniasis
ggo05163  Human cytomegalovirus infection
ggo05165  Human papillomavirus infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05200  Pathways in cancer
ggo05204  Chemical carcinogenesis
ggo05206  MicroRNAs in cancer
ggo05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101146681 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101146681 (PTGS2)
   04064 NF-kappa B signaling pathway
    101146681 (PTGS2)
   04668 TNF signaling pathway
    101146681 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101146681 (PTGS2)
   04657 IL-17 signaling pathway
    101146681 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101146681 (PTGS2)
   04913 Ovarian steroidogenesis
    101146681 (PTGS2)
   04921 Oxytocin signaling pathway
    101146681 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    101146681 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    101146681 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    101146681 (PTGS2)
   05206 MicroRNAs in cancer
    101146681 (PTGS2)
   05204 Chemical carcinogenesis
    101146681 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    101146681 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    101146681 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101146681 (PTGS2)
   05165 Human papillomavirus infection
    101146681 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    101146681 (PTGS2)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101146681 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 101146681
NCBI-ProteinID: XP_004028113
Ensembl: ENSGGOG00000027916
UniProt: G3RPV2
LinkDB All DBs
Position
1
AA seq 604 aa AA seqDB search
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctgtgcgcggtcctggcgctcagccatacagcaaatcct
tgctgttcccacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccagtat
aagtgcgattgtacccggacaggattctatggagaaaactgctcaacaccggaatttttg
acgagaataaaattatttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattccctttcttcgaaatgcaattatgagt
tatgtgttgacatccagatcacatttgattgacagtccaccaacttacaatgctgactat
ggctacaaaagctgggaagccttctctaacctctcctattatactagagcccttcctcct
gtgcctgatgactgcccgactcccttgggtgtcaaaggtaaaaagcagcttcctgattca
aatgagattgtggaaaaattactcctaagaagaaagttcatccctgatccccagggctca
aacatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaatgggctgggccatggggtggacttaaatcatatttat
ggtgaaactctggctagacagcataaactgcgccttttcaaggatggaaaaatgaaatac
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctacggtttgctgtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgggaacacaacagagtatgcgat
gtgcttaaacaggagcatcctgaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtgcaacacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgaatttaacaccctctatcactggcatccccttctgcctgacacc
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatatta
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacaaaaagtgtcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaacgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcggcca
gatgccatctttggtgagaccatggtggaagttggagcaccattctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcatcaaaacagtcaccatcaat
gcaagttcttcccgctccggactagatgatatcaatcccacagtactactaaaagaacgt
tcgactgaactgtag

DBGET integrated database retrieval system