KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146740
Entry
101146740         CDS       T02442                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X2
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04022  cGMP-PKG signaling pathway
ggo04141  Protein processing in endoplasmic reticulum
ggo04151  PI3K-Akt signaling pathway
ggo04211  Longevity regulating pathway
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04668  TNF signaling pathway
ggo04728  Dopaminergic synapse
ggo04911  Insulin secretion
ggo04915  Estrogen signaling pathway
ggo04918  Thyroid hormone synthesis
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo05020  Prion disease
ggo05030  Cocaine addiction
ggo05031  Amphetamine addiction
ggo05034  Alcoholism
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101146740 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101146740 (ATF6B)
   04022 cGMP-PKG signaling pathway
    101146740 (ATF6B)
   04151 PI3K-Akt signaling pathway
    101146740 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101146740 (ATF6B)
   04915 Estrogen signaling pathway
    101146740 (ATF6B)
   04926 Relaxin signaling pathway
    101146740 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    101146740 (ATF6B)
   04918 Thyroid hormone synthesis
    101146740 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    101146740 (ATF6B)
   04925 Aldosterone synthesis and secretion
    101146740 (ATF6B)
   04927 Cortisol synthesis and secretion
    101146740 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101146740 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    101146740 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    101146740 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101146740 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    101146740 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    101146740 (ATF6B)
   05031 Amphetamine addiction
    101146740 (ATF6B)
   05034 Alcoholism
    101146740 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101146740 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101146740 (ATF6B)
   05161 Hepatitis B
    101146740 (ATF6B)
   05163 Human cytomegalovirus infection
    101146740 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101146740 (ATF6B)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101146740 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 101146740
NCBI-ProteinID: XP_004043774
Ensembl: ENSGGOG00000004870
LinkDB
Position
6
AA seq 711 aa
MVGGWGGKMAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCP
EQDVPFDGSSLDVGMDVSPPEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPS
SEALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQTKIEPVSPCS
SVNSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGS
SGKALPTRKPPLQPKPVVLTTVPMPSRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAPSLTRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQP
SFSNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHQPLYLNHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctcagcgagattgctgac
ccgacgcgtttcttcaccgacaacctgcttagcccggaggactggggtctgcagaacagc
accttgtattctggcctagatgaagtggccgaggagcagacgcagctcttccgttgcccg
gagcaggatgtcccgtttgacggcagctccctggacgtggggatggatgtcagcccccct
gagcccccatgggaactcctgccgatcttcccagatcttcaggtgaagtctgagccatct
tccccctgctcttcctcctccctcagctccgagtcatcgcgtctctccacagagccatcc
agcgaggctcttggggtaggggaggtgctccatgtgaagacagagtccttggcaccccca
ctgtgtctcctgggagatgacccaacatcctcatttgaaaccgtccagatcaacgttatc
cccacctctgatgattcctcagatgtccagaccaagatagaacctgtctctccatgttct
tccgtcaactctgaggcctccctgctctcagccgactcctccagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccctgtccccttcaggatgcctcctgtgggat
gtcccagccccctcacttggagctgtccagatcagcatgggcccatcccttgatggctcc
tcaggcaaagccctgcccacccggaagccgccactgcagcccaaacctgtagtgctaacc
acggtcccaatgccatccagagctgtgcctcccagcaccacagtccttctgcagcccctc
gtccagccaccgccagtgtccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccggctccctctctaacacggcctgagaggaagagcatcgttcccgctcctatg
cctggaaactcctgcccgcctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcagcctgccagtcccggagaaagaagaaagagtatctgcaggga
ctggaggctcggctgcaagcagtactggctgacaaccagcagctccgccgagagaatgct
gccctccggcggcggctggaggccctgctggctgaaaacagtgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cctgtcagcatcagtgagcctccttcagctcccatctctcctcggatgaacaagggggag
cctcaaccccggagacacttgctggggttctcagagcaagagccagttcagggagttgaa
cctctccaggggtcctcccagggccctaaggagccccagcccagccccacagaccagccc
agtttcagcaacctgacagccttccctgggggcgccaaggagctactactaagagaccta
gaccagctcttcctctcctctgattgccggcacttcaaccgcactgagtccctgaggctt
gctgacgagttgagtggctgggtccagcgccaccagagaggccggcggaagatccctcag
agggcccaggagagacagaagtctcagccacggaagaagtcacctccagttaaggcagtc
cccatccaaccccctggacccccagaaagggattctgtgggccagctgcaactatatcgc
cacccagaccgttcgcagccagcgttcttggatgcaattgaccgacgggaagacacattt
tatgttgtctctttccgaagggaccacctgctgctcccagccatcagccacaacaagacc
tcccggcccaagatgtccctggtgatgcctgccatggcccccaatgagaccctgtcaggc
cgtggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacagtgcccccctcgctccgaaaacagccatcccca
accccaggcaatgccacaggtggccccttgccagcctctgcagccagccaggcccaccag
gcctcccaccagcccctctacctcaatcatccctga

DBGET integrated database retrieval system