KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101147102
Entry
101147102         CDS       T02442                                 

Gene name
MMP2
Definition
(RefSeq) 72 kDa type IV collagenase isoform X1
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04670  Leukocyte transendothelial migration
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04926  Relaxin signaling pathway
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo05200  Pathways in cancer
ggo05205  Proteoglycans in cancer
ggo05219  Bladder cancer
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101147102 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101147102 (MMP2)
   04915 Estrogen signaling pathway
    101147102 (MMP2)
   04926 Relaxin signaling pathway
    101147102 (MMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101147102 (MMP2)
   05205 Proteoglycans in cancer
    101147102 (MMP2)
  09162 Cancer: specific types
   05219 Bladder cancer
    101147102 (MMP2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101147102 (MMP2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101147102 (MMP2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101147102 (MMP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ggo01002]
    101147102 (MMP2)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     101147102 (MMP2)
Peptidases and inhibitors [BR:ggo01002]
 Metallo peptidases
  Family M10
   101147102 (MMP2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 Reprolysin_4
Other DBs
NCBI-GeneID: 101147102
NCBI-ProteinID: XP_004057705
Ensembl: ENSGGOG00000021966
LinkDB
Position
16
AA seq 660 aa
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggaggcgctaatggcccggggcgcgctcacgggtcccctgagggcgctctgtctcctg
ggctgcctgctgagccacgccgccgccgcgccgtcgcccatcatcaagttccccggcgat
gtcgcccccaaaacggacaaagagttggcagtgcaatacctgaacaccttctatggctgc
cccaaggagagctgcaacctgtttgtgctgaaggacacactaaagaagatgcagaagttc
tttggactgccccagacaggtgatcttgaccagaataccatcgagaccatgcggaagcca
cgctgcggcaacccagatgtggccaactacaacttcttccctcgcaagcccaagtgggac
aagaaccagatcacatacaggatcattggctacacacctgatctggacccagagacggtg
gatgatgcctttgctcgtgccttccaagtctggagcgatgtgaccccactgcggttttct
cgaatccatgatggagaggcagacatcatgatcaactttggccgctgggagcatggcgat
ggatacccctttgatggtaaggacggactcctggctcatgcctttgccccaggcactggt
gttgggggagactcccactttgatgacgatgagctatggaccttgggagaaggccaagtt
gtccgtgtgaagtatgggaacgctgatggggagtactgcaagttccccttcttgttcaat
ggcaaggagtacaacagctgcactgacaccggccgcagcgatggcttcctctggtgctcc
accacctacaactttgagaaggatggcaagtacggcttctgtccccatgaagccctgttc
accatgggcggcaacgctgaaggacagccctgcaagttcccattccgcttccagggcaca
tcctatgacagctgcaccactgagggccgcacggatggctaccgctggtgcggcaccact
gaggactacgaccgcgataagaagtatggcttctgccctgagaccgccatgtccactgtt
ggtgggaactcagaaggtgccccctgtgtcttccccttcactttcctgggcaacaaatat
gagagctgcaccagcgccggccgcagtgacggaaagatgtggtgtgcgaccacagccaac
tacgatgacgaccgcaagtggggcttctgccctgaccaagggtacagcctgttcctcgtg
gcagcccatgagtttggccacgccatggggctggagcactcccaggaccctggggccctg
atggcacccatttacacctacaccaagaacttccgtctgtcccaggatgacatcaagggc
attcaggagctctatggggcctctcctgacattgaccttggcactggccccacccccacg
ctgggccctgtcactcctgagatctgcaaacaggacattgtctttgatggcatcgctcag
atccgtggtgagatcttcttcttcaaggaccggttcatttggcggactgtgacaccacgt
gacaagcccatggggcccctgctggtggccacattctggcctgagctcccggaaaagatt
gatgcggtatacgaggccccacaggaggagaaggctgtgttctttgcagggaatgaatac
tggatctactcagccagcaccctggagcgagggtaccccaagccactgaccagcctggga
ctgccccctgatgtccagcgagtggatgccgcctttaactggagcaaaaacaagaagaca
tacatctttgctggagacaaattctggagatacaatgaggtgaagaagaaaatggatcct
ggcttccccaagctcatcgcagatgcctggaatgccatccctgataacctggatgccgtc
gtggacctgcagggcagcggtcacagctacttcttcaagggtgcctattacctgaagctg
gagaaccaaagtctgaagagcgtgaagtttggaagcatcaaatccgactggctaggctgc
tga

DBGET integrated database retrieval system