KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101147134Help
Entry
101147134         CDS       T02442                                 

Definition
(RefSeq) trypsin-1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04080  Neuroactive ligand-receptor interaction
ggo04972  Pancreatic secretion
ggo04974  Protein digestion and absorption
ggo05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101147134
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    101147134
   04974 Protein digestion and absorption
    101147134
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    101147134
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ggo01002]
    101147134
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101147134
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101147134
Peptidases [BR:ggo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101147134
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101147134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 101147134
NCBI-ProteinID: XP_018886112
LinkDB All DBs
Position
7
AA seq 261 aa AA seqDB search
MHMRETNVFTLKKGRSAPLVFHPPDALIASPFDDDDKIVGGYTCEENSLPYQVSLNSGYH
FCGGSLINEQWVVSAAHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTVNN
DIMLIKLSTPAVINARVSTISLPTAPPAAGTECLISGWGNTASSGADYPDELQCLDAPVL
SQAKCEASYPGEITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKP
GVYTKVYNYVNWIQNTIAANS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgagagagacaaatgtcttcacattgaagaaggggaggagtgcgccattggtt
ttccatcctccagatgcactgattgcttccccctttgatgatgatgacaagatcgttggg
ggctacacctgtgaggagaattctctcccctaccaggtgtccctgaattctggctaccac
ttctgcggtggctccctcatcaatgaacagtgggtggtatcagcagctcactgctacaag
tcccgcatccaggtgcgactgggagagcacaacatcgaagtcctggaggggaatgagcag
ttcataaatgcggccaagatcatccgccacccccaatacgacaggaagactgtgaacaat
gacatcatgctgatcaagctctccacacctgccgtcatcaatgcccgtgtgtccaccatt
tctctgcccaccgcccctccagctgctggcaccgagtgcctcatctccggctggggcaac
actgcgagctctggcgccgactacccagacgagctgcagtgcctggacgctcctgtgctg
agccaggctaagtgtgaagcctcctaccctggagagattaccagcaacatgttctgtgtg
ggcttccttgagggaggcaaggattcctgtcagggtgactctggtggccctgtggtctgc
aatggacagctccaaggagttgtctcctggggtgatggctgtgcccagaagaacaagcct
ggagtctacaccaaggtctacaactatgtgaactggattcagaacaccattgctgccaac
agctaa

DBGET integrated database retrieval system