KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101147653
Entry
101147653         CDS       T02442                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04012  ErbB signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04068  FoxO signaling pathway
ggo04110  Cell cycle
ggo04151  PI3K-Akt signaling pathway
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04934  Cushing syndrome
ggo05162  Measles
ggo05165  Human papillomavirus infection
ggo05169  Epstein-Barr virus infection
ggo05200  Pathways in cancer
ggo05202  Transcriptional misregulation in cancer
ggo05203  Viral carcinogenesis
ggo05206  MicroRNAs in cancer
ggo05215  Prostate cancer
ggo05220  Chronic myeloid leukemia
ggo05222  Small cell lung cancer
ggo05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101147653 (CDKN1B)
   04066 HIF-1 signaling pathway
    101147653 (CDKN1B)
   04068 FoxO signaling pathway
    101147653 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    101147653 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101147653 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101147653 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    101147653 (CDKN1B)
   05206 MicroRNAs in cancer
    101147653 (CDKN1B)
   05203 Viral carcinogenesis
    101147653 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    101147653 (CDKN1B)
   05220 Chronic myeloid leukemia
    101147653 (CDKN1B)
   05215 Prostate cancer
    101147653 (CDKN1B)
   05222 Small cell lung cancer
    101147653 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101147653 (CDKN1B)
   04934 Cushing syndrome
    101147653 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    101147653 (CDKN1B)
   05169 Epstein-Barr virus infection
    101147653 (CDKN1B)
   05165 Human papillomavirus infection
    101147653 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101147653 (CDKN1B)
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 101147653
NCBI-ProteinID: XP_004052799
Ensembl: ENSGGOG00000024780
UniProt: G3SDA9
LinkDB
Position
12
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctggagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacaaacccctagagggcaagtacgagtggcaagaggtggag
aagggcagcttgcccgagttctactacagacccccgcggcccccaaaaggtgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaactctgaggacacgcatttggtggacccaaagactgatccgtcggacagc
cagacggggttagcggagcaatgcgcaggaataaggaagcgacctgcaaccgacgattct
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccaaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system