KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101148250Help
Entry
101148250         CDS       T02442                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00250  Alanine, aspartate and glutamate metabolism
ggo00410  beta-Alanine metabolism
ggo00430  Taurine and hypotaurine metabolism
ggo00650  Butanoate metabolism
ggo01100  Metabolic pathways
ggo04727  GABAergic synapse
ggo04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101148250 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101148250 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101148250 (GAD1)
   00430 Taurine and hypotaurine metabolism
    101148250 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    101148250 (GAD1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    101148250 (GAD1)
Enzymes [BR:ggo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101148250 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 101148250
NCBI-ProteinID: XP_018878027
UniProt: A0A2I2ZG24
LinkDB All DBs
Position
2B
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEQSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccatcttcttccgcaacctcctcgaacgcgggagcggaccccaat
accactaacctgcgccccacaacgtacgatacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcttgcaaaggaccaacagcctggaagagaag
agtcgccttgtgagtgccttcaaggagaggcaatcctccaagaacctgctttcctgtgaa
aacagcgaccgggatgcccgcttccggcgcacagagactgacttctccaatctgtttgct
agagatctgcttccggctaagaacggggaggagcaaactgtgcaattcctcctggaagtg
gtggacatactcctcaactatgtccgcaagacatttgatcgctccaccaaggtgctggac
ttccatcacccacaccagttgctggaaggcatggagggcttcaacttggagctctctgac
caccccgagtccctggagcagatcctggttgactgcagagacaccttgaagtatggggtt
cgcacaggtcatcctcgatttttcaaccagctctccaccggattggatattattggccta
gctggagaatggctgacatcaacggccaataccaacatgtttacatatgaaattgcacca
gtgtttgtcctcatggaacaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctccggggggcgccatatccaacatgtacagcatc
atggctgctcgctacaagtacttcccggaagttaagacaaagggcatggcggctgtgccc
aaactggtcctcttcacctcagaacagagtcactattccataaagaaagctggggctgca
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaaaataatt
ccagctgattttgaggcaaaaattcttgaagccaaacagaagggatatgttcccttttat
gtcaatgcaactgctggcacgactgtttatggagcttttgatccgatacaagagattgca
gatatatgtgagaaatataacctttggctgcatgtcgacgctgcctggggaggtgggctg
ctcatgtccaggaagcaccgccataaactcaatggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggcgtgctgttgcagtgctctgccattctcgtcaaggaa
aagggtatactccaaggatgcaaccagatgtgtgcaggatacctcttccagccagacaag
cagtatgatgtctcctacgacaccggggacaaggcaattcagtgtggccgccacgtggat
atcttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaaccagatc
aacaaatgcctggaactggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggttttcaatggcgagcctgagcacacaaacgtctgtttttggtatattccacaa
agcctcaggggtgtgccagacagccctcaacgacgggaaaagctacacaaggtggctcca
aaaatcaaagccctgatgatggagtcaggtacgaccatggttggctaccagccccaaggg
gacaaggccaacttcttccggatggtcatctccaacccagccgctacccagtctgacatt
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system