KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101149382Help
Entry
101149382         CDS       T02442                                 

Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase-like
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00010  Glycolysis / Gluconeogenesis
ggo00053  Ascorbate and aldarate metabolism
ggo00071  Fatty acid degradation
ggo00260  Glycine, serine and threonine metabolism
ggo00280  Valine, leucine and isoleucine degradation
ggo00310  Lysine degradation
ggo00330  Arginine and proline metabolism
ggo00340  Histidine metabolism
ggo00380  Tryptophan metabolism
ggo00410  beta-Alanine metabolism
ggo00561  Glycerolipid metabolism
ggo00620  Pyruvate metabolism
ggo01100  Metabolic pathways
Module
ggo_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
ggo_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101149382
   00053 Ascorbate and aldarate metabolism
    101149382
   00620 Pyruvate metabolism
    101149382
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101149382
   00561 Glycerolipid metabolism
    101149382
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101149382
   00280 Valine, leucine and isoleucine degradation
    101149382
   00310 Lysine degradation
    101149382
   00330 Arginine and proline metabolism
    101149382
   00340 Histidine metabolism
    101149382
   00380 Tryptophan metabolism
    101149382
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101149382
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101149382
    1.2.1.8  betaine-aldehyde dehydrogenase
     101149382
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     101149382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101149382
NCBI-ProteinID: XP_018868956
LinkDB All DBs
Position
17
AA seq 539 aa AA seqDB search
MWHLPRALCVHAAKTSKLLGPWSRPAAFMSTLLINQPQYAWLKELGLXEENEGVYNGSWG
GRGEVIMTCCPANNXPIARVRQASMADYEETVKKATEAWKMWADIPAPKRGEIVRQIDDA
LWEKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHALIE
QWNPVGLVGIITAFNFPVAVCGWNNAIVMICGNVCLWKGAPTTSLVSVAVTKIIAKVLED
NKLPGAICSLTCGGADTGTAMAKDERVNLLSFTGSTQVGKQMALMVQERFGRSLLELGGN
STIIAFEDADLSLVVPSALFTAVGTAGQRCTTARRLFVHESIHDEVVNRLKKAYAQIRVG
NPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGSTVVYGGKVMDRPGNYVEPTIVTGLAHD
ASIAHTQTFAPILYVFKFKNEEEVFAWNSEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGT
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYVRRSTCTINYSKDFPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcacctgcctcgcgcactgtgtgtgcacgctgcaaagaccagcaagctccttgga
ccttggagcaggcctgctgccttcatgtccactctcctcatcaatcagccccagtatgca
tggctgaaagagctggggctctgagaggaaaatgagggcgtgtataatggaagctgggga
ggccggggagaggttattatgacctgttgccctgctaacaactagccaatagcaagagtc
cgacaggccagtatggcagactatgaagaaactgtaaagaaagcaacagaagcatggaaa
atgtgggcagatattcctgctccaaaacgaggagaaatagtaagacagattgacgatgcc
ttgtgggagaagatccaagtactaggaagcttggtgtctttggagatggggaaaatctta
gtggaaggtgtgggtgaagttcaggagtatgtggatatctgtgactatgctgttggttta
tcaaggatgattggaggacctatcttgccttctgaaagacctggccatgcactgattgag
cagtggaatcctgtaggcctggttggaatcatcacggcattcaatttccctgtggcagtg
tgtggttggaacaacgccattgtcatgatctgtggaaatgtctgcctctggaaaggagct
ccaaccacttccctcgttagtgtggctgtcacaaagataatagccaaggttctggaggac
aacaagctgcctggtgcaatttgttccttgacttgtggtggagcagataccggcacagca
atggccaaagatgaacgagtgaacctgctgtccttcaccgggagcactcaggtgggaaaa
cagatggccctgatggtgcaggagaggtttgggagaagtttgttggaacttggaggaaac
agtaccattattgcctttgaagatgcagacctcagcttagttgttccatcagctctcttc
actgctgtgggaacagctggccagaggtgtaccactgcgaggcgactgtttgtacatgaa
agcatccatgatgaggttgtaaacagacttaaaaaggcctacgcacagatccgagttggg
aacccatgggaccctaatgttctctatgggccactccacaccaagcaggcagtgagcatg
tttcttggagcagtggaagaagcaaagaaagaaggtagcacagtggtctatgggggcaag
gttatggatcgccctggaaattatgtagaaccgacaattgtgacaggtcttgcccacgat
gcatccattgcacacacacagacttttgctccgattctgtatgtctttaaattcaagaat
gaagaagaggtctttgcatggaatagtgaagtaaaacagggactttcaagtagcatcttt
accaaagatctgggcagaatctttcgctggcttggacctaaaggatcagactgtggcact
gtaaatgtcaacattccaacaagtggggctgagattggaggtgcctttggaggagaaaag
catactggtggtggcagggaatctggcagtgatgcctggaaacagtacgtgagaaggtct
acttgtactatcaactacagtaaagactttcctctggcccaaggaatcaagtttcagtaa

DBGET integrated database retrieval system