KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101150285
Entry
101150285         CDS       T02442                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01523  Antifolate resistance
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04064  NF-kappa B signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04137  Mitophagy - animal
ggo04151  PI3K-Akt signaling pathway
ggo04210  Apoptosis
ggo04211  Longevity regulating pathway
ggo04218  Cellular senescence
ggo04380  Osteoclast differentiation
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04622  RIG-I-like receptor signaling pathway
ggo04623  Cytosolic DNA-sensing pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04662  B cell receptor signaling pathway
ggo04668  TNF signaling pathway
ggo04722  Neurotrophin signaling pathway
ggo04917  Prolactin signaling pathway
ggo04920  Adipocytokine signaling pathway
ggo04926  Relaxin signaling pathway
ggo04931  Insulin resistance
ggo04932  Non-alcoholic fatty liver disease
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo05010  Alzheimer disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05030  Cocaine addiction
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05134  Legionellosis
ggo05135  Yersinia infection
ggo05140  Leishmaniasis
ggo05142  Chagas disease
ggo05145  Toxoplasmosis
ggo05146  Amoebiasis
ggo05152  Tuberculosis
ggo05160  Hepatitis C
ggo05161  Hepatitis B
ggo05162  Measles
ggo05163  Human cytomegalovirus infection
ggo05164  Influenza A
ggo05165  Human papillomavirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05168  Herpes simplex virus 1 infection
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05200  Pathways in cancer
ggo05202  Transcriptional misregulation in cancer
ggo05203  Viral carcinogenesis
ggo05212  Pancreatic cancer
ggo05215  Prostate cancer
ggo05220  Chronic myeloid leukemia
ggo05221  Acute myeloid leukemia
ggo05222  Small cell lung cancer
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ggo05321  Inflammatory bowel disease
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101150285 (RELA)
   04014 Ras signaling pathway
    101150285 (RELA)
   04064 NF-kappa B signaling pathway
    101150285 (RELA)
   04668 TNF signaling pathway
    101150285 (RELA)
   04066 HIF-1 signaling pathway
    101150285 (RELA)
   04071 Sphingolipid signaling pathway
    101150285 (RELA)
   04024 cAMP signaling pathway
    101150285 (RELA)
   04151 PI3K-Akt signaling pathway
    101150285 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101150285 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    101150285 (RELA)
   04218 Cellular senescence
    101150285 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101150285 (RELA)
   04621 NOD-like receptor signaling pathway
    101150285 (RELA)
   04622 RIG-I-like receptor signaling pathway
    101150285 (RELA)
   04623 Cytosolic DNA-sensing pathway
    101150285 (RELA)
   04625 C-type lectin receptor signaling pathway
    101150285 (RELA)
   04660 T cell receptor signaling pathway
    101150285 (RELA)
   04658 Th1 and Th2 cell differentiation
    101150285 (RELA)
   04659 Th17 cell differentiation
    101150285 (RELA)
   04657 IL-17 signaling pathway
    101150285 (RELA)
   04662 B cell receptor signaling pathway
    101150285 (RELA)
   04062 Chemokine signaling pathway
    101150285 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101150285 (RELA)
   04917 Prolactin signaling pathway
    101150285 (RELA)
   04926 Relaxin signaling pathway
    101150285 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101150285 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101150285 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    101150285 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101150285 (RELA)
   05202 Transcriptional misregulation in cancer
    101150285 (RELA)
   05203 Viral carcinogenesis
    101150285 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101150285 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101150285 (RELA)
   05221 Acute myeloid leukemia
    101150285 (RELA)
   05220 Chronic myeloid leukemia
    101150285 (RELA)
   05215 Prostate cancer
    101150285 (RELA)
   05222 Small cell lung cancer
    101150285 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101150285 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101150285 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    101150285 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    101150285 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101150285 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101150285 (RELA)
   04931 Insulin resistance
    101150285 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101150285 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101150285 (RELA)
   05135 Yersinia infection
    101150285 (RELA)
   05133 Pertussis
    101150285 (RELA)
   05134 Legionellosis
    101150285 (RELA)
   05152 Tuberculosis
    101150285 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101150285 (RELA)
   05170 Human immunodeficiency virus 1 infection
    101150285 (RELA)
   05162 Measles
    101150285 (RELA)
   05164 Influenza A
    101150285 (RELA)
   05161 Hepatitis B
    101150285 (RELA)
   05160 Hepatitis C
    101150285 (RELA)
   05168 Herpes simplex virus 1 infection
    101150285 (RELA)
   05163 Human cytomegalovirus infection
    101150285 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101150285 (RELA)
   05169 Epstein-Barr virus infection
    101150285 (RELA)
   05165 Human papillomavirus infection
    101150285 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101150285 (RELA)
   05145 Toxoplasmosis
    101150285 (RELA)
   05140 Leishmaniasis
    101150285 (RELA)
   05142 Chagas disease
    101150285 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101150285 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101150285 (RELA)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101150285 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 101150285
NCBI-ProteinID: XP_018892402
Ensembl: ENSGGOG00000011810
UniProt: G3SHV6
LinkDB
Position
11
AA seq 551 aa
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagtacgcatctccctggtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgggacctggagcaggctatcagtcagcgcatccagaccaacaacaacccc
ttccaagttcctatagaagagcagcgtggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggacccatcaggcaggcccctccgcctgccgcctgtcctttct
catcctatctttgacaatcgtgcccccaacactgccgagctcaagatctgccgagtgaac
cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg
caagctgacgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc
agcctgcaggctcctgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc
agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag
aaacgtaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga
cccaccgacccccggcctccacctcgacgcattgctgtgccttcccgcagctcagcttct
gtccccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactat
gatgagtttcccaccatggtgtttccttctgggcagatcagccaggcctcggccttggcc
ccggcccctccccaagtcctgccccaggctccagcccctgcccctgctccagccatggta
tcagctctggcccaggccccagcccctgtcccagtcctagccccaggccctcctcaggct
gtggccccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccctg
ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca
gccgtgttcacagacctggcatccgtcgacaactccgagtttcagcagctgctgaaccag
ggcatacctgtggccccccacacaactgagcccatgctgatggagtaccctgaggctata
actcgcctagtgacaggggcccagaggccccctgacccagctcctgctccactgggggcc
ccggggctccccaatggcctcctttcaggagatgaagacttctcctccattgcggacatg
gacttctcagccctgctgagtcagatcagctcctaa

DBGET integrated database retrieval system