KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101150308
Entry
101150308         CDS       T02442                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101150308 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ggo04030]
    101150308 (PTGDR)
G protein-coupled receptors [BR:ggo04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    101150308 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 PhoR ResB
Other DBs
NCBI-GeneID: 101150308
NCBI-ProteinID: XP_004055222
Ensembl: ENSGGOG00000010473
UniProt: G3R4K5
LinkDB
Position
14
AA seq 359 aa
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLPLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCI
RDRAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaagtcgcccttctaccgctgccagaacaccacctctgtggaaaaaggcaactcggcg
gtgatgggcggggtgctcttcagcaccggcctcctgggcaacctgctggccctggggctg
ctggcgcgctcggggctggggtggtgctcgcggcgtccactgcgcccgctgccctcggtc
ttctacatgctggtgtgtggcctgacggtcaccgacttgctgggcaagtgcctcctaagc
ccggtggtgctggctgcctacgctcagaaccggagtctgcgggtgcttgcgcccgcattg
gacaactcgttgtgccaagccttcgccttcttcatgtccttctttgggctctcctcgaca
ctgcaactcctggccatggcattggagtgctggctctccctagggcaccctttcttctac
cgacggcacatcaccctgcccctgggcgcactggtggccccggtggtgagcgccttctcc
ctggctttctgcgcgctacctttcatgggcttcgggaagttcgtgcagtactgccccggc
acctggtgctttatccagatggtccacgaggagggctcgctgtcggtgctggggtactct
gtgctctactccagcctcatggcgctgctggtcctcgccaccgtgctgtgcaacctcggc
gccatgcgcaacctctatgcgatgcaccggcggctgcagcggcacccgcgctcctgcatc
agggaccgtgccgagccgcgcgcggacgggagggaagcgtcccctcagcccctggaggag
ctggatcacctcctgctgctggcgctgatgaccgtgctcttcactatgtgttctctgccc
gtaatttatcgcgcttactatggagcatttaaggatgtcaaggagaaaaacaggacctct
gaagaagcagaagacctccgagccttgcgatttctatctgtgatttcaattgtggaccct
tggatttttatcattttcagatctccagtatttcggatattttttcacaagattttcatt
agacctcttaggtacaggagccggtgcagcaattccactaacatggaatccagtctgtga

DBGET integrated database retrieval system