KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101150827Help
Entry
101150827         CDS       T02442                                 

Gene name
COLGALT1
Definition
(RefSeq) procollagen galactosyltransferase 1
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00310  Lysine degradation
ggo00514  Other types of O-glycan biosynthesis
ggo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101150827 (COLGALT1)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101150827 (COLGALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ggo01003]
    101150827 (COLGALT1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     101150827 (COLGALT1)
Glycosyltransferases [BR:ggo01003]
 O-Glycan biosynthesis
  O-linked Gal type
   101150827 (COLGALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 101150827
NCBI-ProteinID: XP_030860177
Ensembl: ENSGGOG00000008031
LinkDB All DBs
Position
19
AA seq 622 aa AA seqDB search
MAAAPRAGRRREQPLLALLLLLLAPLQPGAPPGADAYFPEERWSPESPLQAPRVLIALLA
RNAAHALPTTLGALERLRHPRERTALWVATDHNMDNTSTVLREWLVAVKSLYHSVEWRPA
EEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFVDADNLILNPDTLSLL
IAENKTVVAPMLDSRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRGCFAVPMVHSTFLI
DLRKAASRNLAFYPPHPDYTWSFDDIIVFAFSCKQAEVQMYVCNKEEYGFLPVPLRAHST
LQDEAESFMHVQLEVMVKHPPAEPSRFIWAPTKTPDKMGFDEVFMINLRRRQDRRERMLR
ALQAQEIECRLVEAVDGKAMNTSQVEALGIQMLPGYRDPYHGRPLTKGELGCFLSHYNIW
KEVVDRGLQKSLVFEDDLRFEIFFKRRLMNLMRDVEREGLDWDLIYVGRKRMQVEHPEKA
VPRVRNLVEADYSYWTLAYVISLQGARKLLAAEPLSKMLPVDEFLPVMFDKHPVSEYKAH
FSLRNLHAFSVEPLLIYPTHYTGDDGYVSDTETSVVWNNEHVKTDWDRAKSQKMREQQAL
SREAKNSDVLQSPLDSAARDEL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccccacgcgcgggccggcggcgcgagcagccgctcctggcgctgctgctt
ctgctgctggcgccactgcagccgggggccccgccgggcgccgacgcctacttccccgag
gagcgctggagcccggagtcgcccctgcaggcgccgcgcgtgctcatcgcgctgttggcg
cgaaacgcggcccacgcgttgcccaccacgctgggcgcactcgagcggctgcggcacccg
cgggagcgcacggcgctatgggtggctacggaccacaacatggataacacatcaactgtg
ctgcgggagtggctggtggccgtgaagagtttgtaccattccgtggagtggcggccagca
gaggagcccaggtcctacccggacgaggaaggcccgaaacactggtctgactcacgctac
gagcatgtcatgaagttgcgccaggcagccctgaaatcagctcgagacatgtgggctgat
tacatcctgtttgtagatgcggacaacctgatcctcaaccctgacacactgagcctgctc
atcgctgagaacaagacggtggtcgcccccatgctggattcccgggctgcgtactccaac
ttctggtgtggaatgacttcccagggctactacaagcgcacacctgcctacatccccatc
cgcaagcgagaccgccggggctgctttgcagttcccatggtgcactcgaccttcctgatc
gacctgcggaaggcggcgtccaggaacctggccttctacccacctcaccctgactacacc
tggtcctttgacgacatcatcgtctttgccttctcctgcaagcaggcagaggttcagatg
tacgtgtgcaacaaggaggagtacggattcctgccagtgccattgcgcgcccacagcacc
ctccaggatgaggccgagagcttcatgcacgtgcagctggaggtcatggtgaagcacccg
ccagcagagccctcccgcttcatctgggctcccaccaagacaccggacaagatgggcttc
gacgaggtcttcatgatcaacctgaggcggcggcaggaccggcgggagcgcatgctgcgg
gcgctgcaggcacaggagatcgagtgccggctggtggaggccgtggacggcaaagccatg
aacaccagccaggtggaggcgctggggatccagatgctgcctggctaccgggacccctac
cacggccggcccctcaccaagggtgagctgggctgcttcctgagccactacaacatctgg
aaggaggtggtggaccgggggctgcagaaatcgcttgtgtttgaggatgacctgcgtttc
gagatcttcttcaagagacgcctgatgaacctcatgcgggatgtggagcgggagggcctg
gactgggacctcatctatgtgggccggaagcggatgcaggtggagcaccccgagaaggct
gtgccccgcgtgaggaacctggtggaggccgactactcctactggaccctggcctacgtg
atctccctgcaaggcgcccgcaaactgctggctgctgagccactctccaagatgctgcct
gtggacgagttcctgcctgtcatgttcgacaaacacccagtgtccgagtacaaggcccac
ttctccctccgcaacctgcatgccttctccgtggagccgctgctcatctaccccacacac
tacacaggagacgatggctatgtgagtgacaccgagacctcagtcgtatggaacaatgag
cacgtcaagaccgactgggaccgcgccaagtcccagaagatgcgggagcagcaggcactg
agccgtgaggccaagaactcggacgtgctccagtccccactggacagtgctgcccgggat
gaactctga

DBGET integrated database retrieval system