KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101150906Help
Entry
101150906         CDS       T02442                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00010  Glycolysis / Gluconeogenesis
ggo00053  Ascorbate and aldarate metabolism
ggo00071  Fatty acid degradation
ggo00280  Valine, leucine and isoleucine degradation
ggo00310  Lysine degradation
ggo00330  Arginine and proline metabolism
ggo00340  Histidine metabolism
ggo00380  Tryptophan metabolism
ggo00410  beta-Alanine metabolism
ggo00561  Glycerolipid metabolism
ggo00620  Pyruvate metabolism
ggo01100  Metabolic pathways
Module
ggo_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101150906 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    101150906 (ALDH2)
   00620 Pyruvate metabolism
    101150906 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101150906 (ALDH2)
   00561 Glycerolipid metabolism
    101150906 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101150906 (ALDH2)
   00310 Lysine degradation
    101150906 (ALDH2)
   00330 Arginine and proline metabolism
    101150906 (ALDH2)
   00340 Histidine metabolism
    101150906 (ALDH2)
   00380 Tryptophan metabolism
    101150906 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101150906 (ALDH2)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101150906 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1235
Motif
Other DBs
NCBI-GeneID: 101150906
NCBI-ProteinID: XP_004053951
Ensembl: ENSGGOG00000007108
UniProt: G3QW14
LinkDB All DBs
Position
12
AA seq 517 aa AA seqDB search
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAAQAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVLDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgctgccgcccgcttcgggccccgcctgggccgccgcctcttgtcagccgcc
gccacccaggccgtgcctgcccccaatcagcagcccgaggtcttctgcaaccagattttc
ataaacaatgaatggcacgatgccgtcagcaggaaaacattccccaccgtcaatccgtcc
actggagaggtcatctgtcaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggccgcccaggccgccttccagctgggctcaccttggcgccgcatggacgcatcacac
aggggccggctgctgaaccgcctggccgatctgatcgagcgggaccggacctacctggcg
gccttggagaccctggacaatggcaagccctatgtcatctcctacctggtggatttggac
atggtcctcaaatgtctccggtattatgccggctgggctgataagtaccacgggaaaacc
attcccattgacggagacttcttcagctacacacgccatgaacctgtgggggtgtgcggg
cagatcattccgtggaatttcccgctcctgatgcaagcatggaagctgggcccagccttg
gcgactggaaacgtggttgtgatgaaggtagctgagcagacacccctcaccgccctctat
gtggccaacctgatcaaggaggccggctttccccctggtgtggtcaacattgtgcctgga
tttggccccacggctggggccgccattgcctcccacgaggatgtggacaaagtggcattc
acaggctccactgagattggccgcgtaatccaggttgctgctgggagcagcaacctcaag
agagtgaccctggagctgggggggaagagccccaacatcatcatgtcagatgccgatatg
gattgggccgtggaacaggcccacttcgccctgttcttcaaccagggccagtgctgctgt
gccggctcccggaccttcgtgcaggaggacatctatgatgagtttgtggagcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgatagcaagaccgagcaggggccg
caggtggatgaaactcagtttaagaagatcctcggctacatcaacacggggaaacaagag
ggggcgaagctgctgtgtggtgggggcattgctgctgaccgtggttacttcatccagccc
actgtgtttggagatgtgctggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagatcctgaagttcaagaccatagaggaggttgttgggagagccaacaattcc
acgtacgggctggccgcagctgtcttcacaaaggatttggacaaggccaattacctgtcc
caggccctccaggcgggcactgtgtgggtcaactgctatgatgtgtttggagcccagtca
ccctttggtggctacaagatgtcggggagtggccgggagctgggcgagtacggcctgcag
gcatacactgaagtgaaaactgtcacagtcaaagtgcctcagaagaactcataa

DBGET integrated database retrieval system