KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101151075
Entry
101151075         CDS       T02442                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04015  Rap1 signaling pathway
ggo04151  PI3K-Akt signaling pathway
ggo04390  Hippo signaling pathway
ggo04810  Regulation of actin cytoskeleton
ggo05200  Pathways in cancer
ggo05218  Melanoma
ggo05224  Breast cancer
ggo05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101151075 (FGF1)
   04014 Ras signaling pathway
    101151075 (FGF1)
   04015 Rap1 signaling pathway
    101151075 (FGF1)
   04390 Hippo signaling pathway
    101151075 (FGF1)
   04151 PI3K-Akt signaling pathway
    101151075 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101151075 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101151075 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101151075 (FGF1)
   05218 Melanoma
    101151075 (FGF1)
   05224 Breast cancer
    101151075 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ggo04052]
    101151075 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:ggo00536]
    101151075 (FGF1)
Cytokines and growth factors [BR:ggo04052]
 Growth factors
  Growth factors (RTK binding)
   101151075 (FGF1)
Glycosaminoglycan binding proteins [BR:ggo00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101151075 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101151075
NCBI-ProteinID: XP_004042785
Ensembl: ENSGGOG00000025578
UniProt: G3RPE3
LinkDB
Position
5
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccaccttcacagccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaatgggggccacttcttgaggatc
cttccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaag
aattggtttgttggcctcaagaagaatggaagctgcaaacgcggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcttccgattaa

DBGET integrated database retrieval system