KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101152161
Entry
101152161         CDS       T02442                                 

Gene name
NLRP4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ggo04131]
    101152161 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ggo04054]
    101152161 (NLRP4)
Membrane trafficking [BR:ggo04131]
 Autophagy
  Other autophagy associated proteins
   Others
    101152161 (NLRP4)
Pattern recognition receptors [BR:ggo04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   101152161 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 VirE AAA_14 AAA_22 ResIII AAA_25 RsgA_GTPase AAA_30
Other DBs
NCBI-GeneID: 101152161
NCBI-ProteinID: XP_018870421
Ensembl: ENSGGOG00000016786
LinkDB
Position
19
AA seq 994 aa
MAASFFSDFGLMWYLEELKKEEFRKFKEHLKQMTLHLELKQIPWTEVKKASREELANLLI
KHYEEQQAWNITLRIFQKMDRRDLCMKVMRERTGYTKTYQAHAKQKFSRLWSSKSVTEIQ
LYFEEEVKQEECDHLDRLFAPKETWKQPRTVIIQGPQGIGKTTLLMKLMMAWSDNKIFRD
RFLYTFYFCCRELRELPPTSLADLISREWPDPAAPITEIVSQPERLLFVIDSFEELQGGL
NEPDSDLCGDLMEKRPVQVLLSSLLRKKMLPEASLLIAVKPECPKELRDLVTISEIYQPR
GFNESDRLVYFCCFFKDPKRAMEAFSLVRESEQLFSICQIPLLCWILCTSLKQEMQKGKD
LVLTCQSTTSVYSSFVFNLFTPEGAQGPTPQSQHQLKALCSLAAEGMWTDTFEFCEDDLQ
RNGVVDADIPALLGTKILLKYGERESSYVFLHVCIQEFCAALFYLLKSHLDHPHPAVRCV
QELLVANFEKARRAHWIFLGCFLTGLLNKKEQEKLDAFFGFQLSQEIKQQFHQCLKSLGE
RGNPQGQVDSLAIFYCLFEMQDPAFVKQAVNLLQEANFHIIDNVDLVVSAYCLKYCSSLR
KLCFSVQNVFKKEDEHSSTSDYSLVCWHHICSVLTTSGHLRELQVQDSTLSESTFVTWCN
QLRHPSCHLQKLGINNVSFSGQSVLLFEVLFYQPDLKYLSFTLTKLSRDDIRSLCDALNY
PAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTV
LVYLMLAFCHLSEQCCEYISEMLLRNKSVRYLDLGANVLKDEGLKTLCEALKHPDCCLDS
LCLVKCFITAAGCEDLGSALISNQNLKILQIGCNEIRDVGVQLLCRALTHPDCRLEILGL
EECGLTSACCKDLASVLTCSKTLQQLNLTLNALDHTGVVVLCEALRHPECALQVLGLRKT
DFDEETQALLTAEEERNPNLTITDDCDTITRVEI
NT seq 2985 nt   +upstreamnt  +downstreamnt
atggcagcctctttcttctctgattttggtcttatgtggtatctggaggagctcaaaaag
gaggagttcaggaaatttaaagaacatctcaagcaaatgactttgcatcttgaactcaag
cagattccctggactgaggtcaaaaaagcatcccgggaagaacttgcaaacctcttgatc
aagcactatgaagaacaacaagcttggaacataaccttaagaatctttcaaaagatggat
agaagggatctctgcatgaaggtcatgagggagagaacaggatacacaaagacctatcaa
gctcacgcaaagcagaaattcagccgcttatggtccagcaagtctgtcactgagattcag
ctatactttgaggaggaagtcaagcaagaagaatgtgaccatttggaccgcctttttgct
cccaaggaaacttggaaacagccacgtacagtgatcattcaaggaccacaaggaattgga
aaaacgacactcctgatgaagctgatgatggcctggtcggacaacaagatctttcgggat
aggttcctgtacacgttctatttctgctgcagagaactgagggagttgccgccaacgagt
ttggctgacttgatttccagagagtggcctgaccccgctgctcctataacagagatcgtg
tctcaaccggagagactcttgttcgtcatcgacagcttcgaagagctgcagggcggcttg
aacgaacccgattcagatctgtgtggtgacttgatggagaaacggccggtgcaggtgctt
ctgagcagtttgctgaggaagaagatgctcccggaggcctccctgctcatcgccgtcaaa
cccgagtgcccgaaggagctccgggatctggtgacgatctcagaaatctaccagccccgg
ggattcaatgagagtgataggttagtgtatttctgctgtttcttcaaagacccgaaaaga
gccatggaagccttcagtcttgtaagagaaagtgaacagctgttttccatatgccaaatc
ccgctcctctgctggatcctgtgtactagtctgaagcaagagatgcagaaaggaaaagac
ctggtcctgacctgccagagcactacctctgtgtactcctctttcgtctttaacctgttc
acacccgagggtgcccagggcccgactccgcaaagccagcaccagctgaaggccctgtgc
tccctggctgcagagggcatgtggacagacacatttgagttttgtgaagacgacctccag
agaaatggggttgttgatgctgacatccctgcgctgctgggcaccaagatacttctgaag
tacggggagcgtgagagctcctacgtgttcctccacgtgtgtatccaggagttctgtgcc
gccttgttctatttgctcaagagccaccttgatcatcctcacccagctgtgagatgtgta
caggaattgctagttgccaattttgaaaaagcaaggagagcacattggatttttttgggg
tgttttctaactggccttttaaataaaaaggaacaagaaaaactggatgcgttttttggc
ttccaactgtcccaagagataaagcagcaatttcaccagtgcctgaagagtttaggggag
cgtggcaatcctcagggacaggtggattccttggcgatattttactgtctctttgaaatg
caggatcctgcctttgtgaagcaggcagtgaacctcctccaagaagctaactttcatatt
attgacaacgtggacttggtggtttctgcctactgcttaaaatactgctccagcttgagg
aaactctgtttttccgttcaaaatgtctttaagaaagaggatgaacacagctctacgtcg
gattacagcctcgtctgttggcatcacatctgctctgtgctcaccaccagcgggcacctc
agagagctccaggtgcaggacagcaccctcagcgagtcgacctttgtgacctggtgtaac
cagctgaggcatcccagctgtcaccttcagaagcttggaataaataacgtttccttttct
ggccagagtgttctgctctttgaggtgctcttttatcagccagacttgaaatacctgagc
ttcaccctcacgaaactctctcgtgatgacatcaggtccctctgtgatgccttgaactac
ccagcaggcaacgtcaaagagctagcgctggtaaattgtcacctctcacccattgattgt
gaagtccttgctggccttctaaccaacaacaagaagctgacgtatctgaatgtatcctgc
aaccagttagacacaggcgtgccgcttttgtgtgaagccctgtgcagcccagacacggtc
ctggtatacctgatgttggctttctgccacctcagcgagcaatgctgcgaatacatctct
gaaatgcttctgcgtaacaagagcgtgcgctatctagacctcggtgccaatgtcctgaag
gacgaaggactgaaaactctctgcgaggccttgaaacatccggactgctgcctggattcg
ctgtgtttggtaaaatgttttatcactgctgccggctgtgaagacctcggctctgctctc
atcagcaatcaaaacctgaagattctgcaaattgggtgcaatgaaatcagagatgtgggc
gtgcagctgttgtgtcgggctctgacgcatccggattgccgcttagagattcttgggttg
gaagaatgtgggttaacgagcgcctgctgtaaggatctcgcctctgttctcacctgcagt
aagaccctgcagcagctcaacctgaccttgaatgccttggaccacacaggggtggtggtt
ctctgtgaggccctgagacacccagagtgtgccctgcaggtgctcgggctgagaaaaact
gattttgatgaggaaacccaggcacttctgacggctgaggaagagagaaatcctaacctg
accatcacagacgactgtgacacaatcacaagggtagagatctga

DBGET integrated database retrieval system