KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101152448
Entry
101152448         CDS       T02442                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04020  Calcium signaling pathway
ggo04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101152448 (CACNA1E)
   04020 Calcium signaling pathway
    101152448 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101152448 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ggo04040]
    101152448 (CACNA1E)
Ion channels [BR:ggo04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101152448 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 101152448
NCBI-ProteinID: XP_018883052
Ensembl: ENSGGOG00000011090
LinkDB
Position
1
AA seq 1945 aa
MKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRTEAMTRDS
SDEHCVDISSVGTPLARASIKSAKVDGVSYFRHKERLLRISIRHMVKSQVFYWIVLSLVA
LNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGV
TVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLL
FLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGI
RSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKH
ALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRK
HMQMSSQEALNREEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLALGLALEKFEE
ERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAGGGEAVVT
FEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAMPTEGEKDHELRGNHG
AKEPTIQEERAQDLRRTNSLMVSRGSGLAGGLDEADTPLVLPHPELEVGKHVVLTEQEPE
GSSEQALLGNVQLDMGRVISQSEPDLSCITANTDKATTESTSVTVAIPDVDPLVDSTVVH
ISNKTDGEASPLKEAEIREDEEEVEKMKKKEKRETGKAMVPHSSMFIFSTTNPIRRACHY
IVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQ
GLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKT
IKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKE
CIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEED
RGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACID
FAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYEL
ALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTS
GFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQV
FGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQ
NENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVW
AEYDRAACGRIPYKDMYKLVRVISPPLGLGENCPYRVACKRLVLMNMPVAEDMTVHFTST
LMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKI
YAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDPVSG
LSGRSGYPSMSPLSPQDIFQLACMDPADDGQFQERQSLEPEVSELKSVQPSNHGIYLPSD
TQEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYK
SRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQ
ADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDTSTPRRSRRQLPPVPPKPRP
LLSYSSLIRHAGSISPPADGSEEGSPLTSQALESNNACLTESSNSPHPQQSQHASPQRYI
SEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRR
GGPGPGMMCGAVNNLLSDTEEDDKC
NT seq 5838 nt   +upstreamnt  +downstreamnt
atgaagctgcggcgccagcagcagattgagcgtgagctgaatggctaccgtgcctggata
gacaaagcagaggaagtcatgctcgctgaagaaaataaaaatgctggaacatccgcctta
gaagtgcttcgaagggcaaccatcaagaggagccggacagaggccatgactcgagactcc
agtgatgagcactgtgttgatatctcctctgtgggcacacctctggcccgagccagtatc
aaaagtgcaaaggtagacggggtctcttatttccggcacaaggaaaggcttctgcgcatc
tccattcgccacatggttaaatcccaggtgttttactggattgtgctgagccttgtggca
ctcaacactgcctgtgtggccattgtccatcacaaccagccccagtggctcacccacctc
ctctactatgcagaatttctgtttctgggactcttcctcttggagatgtccctgaagatg
tatggcatggggcctcgcctttattttcactcttcattcaactgctttgattttggggtc
acagtgggcagtatctttgaagtggtctgggcaatcttcagacctggtacgtcgtttgga
atcagtgtcttgcgagccctccggcttctaagaatatttaaaataaccaagtattgggct
tccctacggaatttggtggtctccttgatgagctcaatgaagtctatcatcagtttgctt
ttcctcctcttcctcttcatcgttgtctttgctctcctaggaatgcagttatttggaggc
aggtttaactttaatgatgggactccttcagcaaattttgataccttccctgcagccatc
atgaccgtgttccagatcctgacgggtgaggactggaatgaggtgatgtacaatgggatc
cgctcccagggcggggtcagctcaggcatgtggtctgccatctacttcattgtgctcacc
ttgtttggcaactacacgctactgaatgtgttcttggctatcgctgtggataatctcgcc
aatgcccaggaactgaccaaggatgaacaggaggaagaagaggccttcaaccagaaacat
gcactgcagaaggccaaggaggtcagcccgatgtctgcacccaacatgccttcgatcgaa
agagacagaaggagaagacaccacatgtcgatgtgggagccacgcagcagccacctgagg
gagcggaggcgccggcaccacatgtccgtgtgggagcagcgtaccagccagctgaggaag
cacatgcagatgtccagccaggaggccctcaacagggaggaggcgccgaccatgaacccg
ctcaaccccctcaacccgctcagctccctcaacccactcaatgcccaccccagcctttat
cggcgacccagggccattgagggcctggccctgggcctggccctggagaagtttgaggag
gagcgtatcagccgtggggggtccctcaagggggatggaggggaccgatccagtgccctg
gacaaccagaggacccctttgtccctgggccagcgggagccaccgtggctggccaggccc
tgtcatggaaactgtgacccgactcagcaggaggcggggggaggagaggctgtggtgacc
tttgaggaccgggccagacacaggcagagccaacggcgcagccggcatcgccgcgtcagg
acagaaggcaaggagtcctcttcagcctcccggagcaggtctgccagccaggaacgcagt
ctggatgaagccatgcccactgaaggggagaaggaccatgagctcaggggcaaccatggt
gccaaggagccaacgatccaagaagagagagcccaggatttaaggaggaccaacagtctg
atggtgtccagaggctccgggctggcaggaggccttgatgaggctgacacccctctagtc
ctgccccatcctgagctggaagtggggaagcacgtggtgctgacggagcaggagccagaa
ggcagcagtgagcaggccctgctggggaatgtgcagctagacatgggccgggtcatcagc
cagagcgagcccgacctctcctgcatcacggccaacacggacaaggccaccaccgagagc
accagcgtcaccgtcgccatccccgatgtggaccccttggtggactcaaccgtggtgcac
attagcaacaagacggatggggaagccagtcccttgaaggaggcagagatcagagaggat
gaggaggaggtggagaagatgaagaagaaggagaagcgtgagacaggcaaagccatggtg
ccccacagctcaatgttcatcttcagcaccaccaacccgatccggagggcctgccactac
atcgtgaacctgcgctactttgagatgtgcatcctcctggtgattgcagccagcagcatc
gccctggcggcagaggaccccgtcctgaccaactcggagcgcaacaaagtcctgaggtat
tttgactatgtgttcacgggcgtgttcacctttgagatggttataaagatgatagaccaa
ggcttgatcctgcaggatgggtcctacttccgagacttgtggaacatcctggactttgtg
gtggttgttggcgcattggtggcctttgctctggcgaacgctttgggaaccaacaaagga
cgggacatcaagaccatcaagtctctgcgggtgctccgagttctgaggccactgaaaacc
atcaagcgcttgcccaagctcaaggccgtcttcgactgcgtagtgacctccttgaagaat
gtcttcaacatactcattgtctacaagctcttcatgttcatctttgctgtcatcgcagtt
cagctcttcaaaggaaagttcttttattgcacggacagttccaaggacacagagaaggag
tgcataggcaactatgtagatcatgagaaaaacaagatggaggtgaagggccgggaatgg
aagcgccatgaattccactacgacaacattatctgggccctgctgaccctcttcaccgtc
tccacaggggaaggatggcctcaagttctgcagcactctgtggatgtgacagaggaagac
cgaggcccaagccgcagcaaccgcatggagatgtctatcttttatgtggtctactttgtg
gtcttccccttcttctttgtcaatatctttgtggctctcatcatcatcaccttccaggag
caaggggataagatgatggaggagtgcagcctggagaagaatgagagggcgtgcatcgac
ttcgccatcagcgccaaacctctcacccgctacatgccgcagaacagacacaccttccag
taccgcgtgtggcactttgtggtgtctccgtcctttgagtacaccattatggccatgatc
gccttgaatactgttgtgctgatgatgaagtattactctgctccctgtacctatgagctg
gccctgaagtacctgaatatcgccttcaccatggtgttttccctggaatgcgtcctgaag
gtcatcgcttttggctttttgaactatttccgagacacctggaatatctttgacttcatc
accgtgattggcagtatcacagaaattatcctgacagacagcaagctggtgaacaccagt
ggcttcaatatgagctttctgaagctcttccgagctgcccgcctcataaagctcctgcgt
cagggctataccatacgcattttgctgtggacctttgtgcagtcctttaaggccctccct
tatgtctgccttttaattgccatgcttttcttcatttatgccatcattgggatgcaggta
tttggaaacataaaattagacgaggagagtcacatcaaccggcacaacaacttccggagt
ttctttgggtccctaatgctactcttcaggagtgccacaggtgaggcctggcaggagatt
atgctgtcatgccttggggagaagggctgtgagcctgacaccaccgcaccatcagggcag
aacgagaacgaacgctgcggcaccgatctggcctacgtgtactttgtctccttcatcttc
ttctgctccttcttgatgctcaacctgttcgtggccgtcatcatggacaactttgagtac
ctgactcgggactcctccatcctggggcctcaccacttggacgagtttgtccgcgtctgg
gcagaatatgaccgagcagcatgcggcaggatcccgtataaggatatgtacaaattagtg
cgggtgatctcgcctcctctgggcctgggagagaactgcccctacagggtggcttgcaag
aggttggtcctaatgaacatgccagtagctgaggacatgacggtccacttcacctccaca
cttatggctctgatccggacagctctggacattaaaattgccaaaggtggtgcagacagg
cagcagctagactcagagctacaaaaggagaccctagccatctggcctcacctatcccag
aagatgctggatctgcttgtgcccatgcccaaagcctctgacctgactgtgggcaaaatc
tatgcagcaatgatgatcatggactactataagcagagtaaggtgaagaagcagaggcag
cagctggaggaacagaaaaatgcccccatgttccagcgcatggagccttcatctctgcct
caggagatcattgctaatgccaaagccctgccttacctccagcaggaccccgtttcaggc
ctgagtggccggagtggatacccttcgatgagtccactctctccccaggatatattccag
ttggcttgtatggaccccgccgatgatggacagttccaagaacggcagtctctggagcca
gaggttagtgaattaaaaagcgtgcagccctctaaccatggcatctaccttccttcggac
acccaggagcatgcgggatctgggagggcatcttctatgccacgtctgactgtggatccc
caggtggtgacagaccctagctccatgagacgttcattttccactattcgggataagcgt
tcaaattcctcgtggttggaggaattctccatggagcgaagcagtgaaaatacctacaag
tcccgtcgccggagttaccactcctccttgcggctgtcagcccaccgcctgaactctgat
tcaggccacaagtctgacactcaccgctcagggggcagggagcggggacgatcaaaagag
cgaaagcatcttctctctcctgatgtctcccgctgcaattcagaagagcgagggacccag
gctgactgggagtccccagagcgccgtcaatccaggtcacccagtgagggcaggtcacag
acgcccaacagacagggcacaggttccctaagtgagagctccatcccctctgtctctgac
accagcaccccaagaagaagtcgtcggcagctcccacccgtcccgccaaagccccggccc
ctcctttcctacagctccctgattcgacacgcgggtagcatctctccacctgctgatgga
agcgaggagggctccccgctgacctcccaagctctggagagcaacaatgcttgcctgacc
gagtcttccaactctccgcacccccagcagagccaacatgcctccccacagcgctacatc
tccgagccctacttggccctgcacgaagactcccatgcctcagactgtggcgaggaggag
acgctcactttcgaagcagccgtggctactagcctgggccgttccaacaccatcggctca
gccccacccctgcggcatagctggcagatgcccaacgggcactatcggcggcggaggcgc
ggggggcctgggccaggcatgatgtgtggggctgtcaacaacctgctaagtgacacggaa
gaagatgacaaatgctag

DBGET integrated database retrieval system