KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101153251
Entry
101153251         CDS       T02442                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01521  EGFR tyrosine kinase inhibitor resistance
ggo01522  Endocrine resistance
ggo04012  ErbB signaling pathway
ggo04015  Rap1 signaling pathway
ggo04062  Chemokine signaling pathway
ggo04137  Mitophagy - animal
ggo04144  Endocytosis
ggo04360  Axon guidance
ggo04370  VEGF signaling pathway
ggo04510  Focal adhesion
ggo04520  Adherens junction
ggo04530  Tight junction
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04625  C-type lectin receptor signaling pathway
ggo04727  GABAergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04810  Regulation of actin cytoskeleton
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04917  Prolactin signaling pathway
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04926  Relaxin signaling pathway
ggo05100  Bacterial invasion of epithelial cells
ggo05135  Yersinia infection
ggo05152  Tuberculosis
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05168  Herpes simplex virus 1 infection
ggo05203  Viral carcinogenesis
ggo05205  Proteoglycans in cancer
ggo05219  Bladder cancer
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101153251 (SRC)
   04015 Rap1 signaling pathway
    101153251 (SRC)
   04370 VEGF signaling pathway
    101153251 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101153251 (SRC)
   04137 Mitophagy - animal
    101153251 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101153251 (SRC)
   04520 Adherens junction
    101153251 (SRC)
   04530 Tight junction
    101153251 (SRC)
   04540 Gap junction
    101153251 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101153251 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101153251 (SRC)
   04625 C-type lectin receptor signaling pathway
    101153251 (SRC)
   04062 Chemokine signaling pathway
    101153251 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101153251 (SRC)
   04915 Estrogen signaling pathway
    101153251 (SRC)
   04917 Prolactin signaling pathway
    101153251 (SRC)
   04921 Oxytocin signaling pathway
    101153251 (SRC)
   04926 Relaxin signaling pathway
    101153251 (SRC)
   04919 Thyroid hormone signaling pathway
    101153251 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    101153251 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101153251 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    101153251 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101153251 (SRC)
   05203 Viral carcinogenesis
    101153251 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    101153251 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101153251 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101153251 (SRC)
   05152 Tuberculosis
    101153251 (SRC)
   05100 Bacterial invasion of epithelial cells
    101153251 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101153251 (SRC)
   05168 Herpes simplex virus 1 infection
    101153251 (SRC)
   05163 Human cytomegalovirus infection
    101153251 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101153251 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101153251 (SRC)
   01522 Endocrine resistance
    101153251 (SRC)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101153251 (SRC)
Protein kinases [BR:ggo01001]
 Non-receptor tyrosine kinases
  SRC family
   101153251 (SRC)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101153251 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    101153251 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101153251 (SRC)
  Macropinocytosis
   Kinases
    101153251 (SRC)
SSDB
Motif
Pfam: SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 101153251
NCBI-ProteinID: XP_030860662
Ensembl: ENSGGOG00000007437
LinkDB
Position
20
AA seq 278 aa
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKV
DVSQTWFTFRWLQREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESER
LLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQF
NSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKD
NT seq 834 nt   +upstreamnt  +downstreamnt
atgggtagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
gccgagaacgtgcacggcgctggcgggggcgctttccccgcctcgcagacccccagcaag
ccagcctcggccgacggccaccgcggccccagcgcggccttcgcccccgcggccgccgag
cccaagctgttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcgggc
ccgctggccggtggagtgaccacctttgtggccctctatgactatgagtctaggacggag
acagacctgtccttcaagaaaggcgagcggctccagattgtcaacaacacgaggaaggtg
gatgtcagccagacctggttcacattcagatggctgcaaagagagggagactggtggctg
gcccactcgctcagcacaggacagacaggctacatccccagcaactacgtggcgccctcc
gactccatccaggccgaggagtggtattttggcaagatcaccagacgggagtcagagcgg
ttactgctcaatgcggagaacccgagagggaccttcctcgtgcgagaaagtgagaccacg
aaaggtgcctactgcctctcagtgtctgacttcgacaatgccaagggcctcaacgtgaag
cactacaagatccgcaagctggacagcggcggcttctacatcacctcccgcacccagttc
aacagcctgcagcagctggtggcctactactccaaacacgccgatggcctgtgccaccgc
ctcaccaccgtgtgtcccacgtccaagccgcagactcagggcctggccaaggat

DBGET integrated database retrieval system