KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101153886
Entry
101153886         CDS       T02442                                 

Gene name
AIM2
Definition
(RefSeq) interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04621  NOD-like receptor signaling pathway
ggo04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101153886 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    101153886 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon DUF2950
Other DBs
NCBI-GeneID: 101153886
NCBI-ProteinID: XP_018880642
Ensembl: ENSGGOG00000006135
LinkDB
Position
1
AA seq 346 aa
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATLMIQNAGAVS
AVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAEMSPAASAAIRNDVAK
QRAAPKVSPHVKPEQKQMVAQQESIREGFQKDCLPVMVLKAKKPFTFETQEGKQEMFHAT
VATEKEFFFVKVFDTLLKDKFIPKRIIIISRYYRHSGFLEVNSASCVLDAESDQKVNVPL
NIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNVLFDLSDNTGKMEVLVVRNED
TMKCKEGDKVRLTFFTLSKNGEKLQLTFGVHSTIKVIKAKKKTIEK
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagagtaaatacaaggagatactcttgctaacaggcctggataacatcactgatgag
gaactggataggtttaagttctttctttcagacgagtttaatatcgccacaggcaaacta
catactgcaaacagaatacaagtagctaccttgatgattcaaaatgctggggcggtgtct
gcagtgatgaagaccattcgtatttttcagaagttgaattatatgcttttggcaaaacgt
cttcaggaagagaaggagaaagttgataagcaatacaaatcggtaacaaaaccaaagcca
ctaagtcaagctgaaatgagtcctgctgcatctgcagccatcagaaatgatgtcgcaaag
caacgtgctgcaccaaaagtctctcctcatgttaagcctgaacagaaacagatggtggcc
cagcaggaatctatcagagaagggtttcagaaagactgtttgccagttatggtactgaaa
gcaaagaagcccttcacgtttgagacccaagaaggcaagcaggagatgtttcatgctaca
gtggctacagaaaaggaattcttctttgtaaaagtttttgatacactgctgaaagataaa
ttcattccaaagagaataattataatatcaagatattatcggcacagtggtttcttagag
gtaaatagtgcctcatgtgtgttagatgctgaatctgaccaaaaggttaatgtcccactg
aacattatcagaaaagctggtgaaaccccgaagatcaacacgcttcaaactcagcccctt
ggaacaattgtgaatggcttgtttgtagtccagaaggtaacagaaaagaagaaaaacgta
ttatttgacctaagtgacaacactgggaaaatggaagtactggtggttagaaacgaggac
acaatgaaatgtaaggaaggagataaggttcgacttacattcttcacactgtcaaaaaat
ggagaaaaactacagctgacatttggagttcatagcaccataaaggttattaaggccaaa
aaaaaaaccatagagaaataa

DBGET integrated database retrieval system