KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101154327Help
Entry
101154327         CDS       T02442                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    101154327 (TGM2)
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101154327 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 101154327
NCBI-ProteinID: XP_018872459
Ensembl: ENSGGOG00000013498
UniProt: G3RCE0
LinkDB All DBs
Position
20
AA seq 687 aa AA seqDB search
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDLEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGISPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SIPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggagctggtcttagagaggtgtgatctggagctggagaccaatggccgagac
caccacacggccgacctgtgccgggagaagctggtggtgcgacggggccagcccttctgg
ctgaccctgcactttgagggccgcaactacgaggccagtgtagacagtctcaccttcagt
gtcgtgaccggcccagcccctagccaggaggctgggaccaaggcccgttttccactaaga
gatgctgtggaggagggtgactggacagccaccgtggtggaccagcaagactgcaccctc
tcgctgcagctcaccaccccggccaacgcccccatcggcctgtatcgcctcagcctggag
gcctccactggctaccagggatccagctttgtgctgggccacttcatcttgctcttcaac
gcctggtgcccagcggatgctgtgtacctggacttggaagaggagcggcaggagtacgtc
ctcacccagcagggctttatctaccagggctcggccaagttcatcaagaacataccttgg
aattttgggcagtttgaagatgggatcctagacatctgcctgatccttctagatgtcaat
cccaagttcctgaagaacgccggccgtgactgctcccgccgcagcagccccgtctacgtg
ggccgggtggtgagcggcatggtcaactgcaatgatgaccagggtgtgctgctgggacgc
tgggacaacaactacggggacggcatcagccccatgtcctggatcggcagcgtggacatc
ctgcggcgctggaagaaccacggctgccagcgcgtcaagtatggccagtgctgggtcttc
gccgccgtggcctgcacagtgctgaggtgcctgggcatccctacccgcgtcgtgaccaac
tacaactcggcccatgaccagaacagcaaccttctcatcgagtacttccgcaatgagttt
ggggagatccagggtgacaagagcgagatgatctggaacttccactgctgggtggagtcg
tggatgaccaggccggacctgcagccggggtacgagggctggcaggccctggacccaacg
ccccaggagaagagcgaagggacgtactgctgtggcccagttccagttcgtgccatcaag
gagggcgacctgagcaccaagtacgatgcgccctttgtctttgcggaggtcaatgccgac
gtggtagactggatccagcaggacgatgggtctgtgcacaaatctatcaaccgttccctg
attgttgggctgaagatcagcactaagagcgtgggccgagacgagcgggaggatatcacc
cacacctacaaatacccagaggggtcctcagaggagagggaggccttcacaagggcgaac
cacctgaacaaactggctgagaaggaggagacagggatggccatgcggatccgtgtgggc
cagagcatgaacatgggcagtgactttgacgtctttgcccacatcaccaacaacaccgct
gaggagtacgtctgccgcctcctgctctgtgcccgcaccgtcagctacaatgggatcttg
gggcccgagtgtggcaccaagtacctgctcaacctcaacctggagcctttctctgagaag
agcattcctctttgcatcctctatgagaaataccgtgactgccttacggagtccaacctc
atcaaggtgcgggccctcctcgtggagccagttatcaacagctacctgctggctgagagg
gacctctacctggagaatccagaaatcaagatccggatccttggggagcccaagcagaaa
cgcaagctggtggctgaggtgtccctgcagaacccgctccctgtggccctggaaggctgc
accttcactgtggagggggctggcctgactgaggagcagaagacggtggagatcccagac
cccgtggaggcaggggaggaagttaaggtgagaatggacctgctgccgctccacatgggc
ctccacaagctggtggtgaacttcgagagtgacaagctgaaggctgtgaagggcttccgg
aatgtcatcattggccccgcctaa

DBGET integrated database retrieval system