KEGG   Gorilla gorilla gorilla (western lowland gorilla): 109023024Help
Entry
109023024         CDS       T02442                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04110  Cell cycle
ggo04213  Longevity regulating pathway - multiple species
ggo04330  Notch signaling pathway
ggo04919  Thyroid hormone signaling pathway
ggo05016  Huntington disease
ggo05034  Alcoholism
ggo05165  Human papillomavirus infection
ggo05169  Epstein-Barr virus infection
ggo05200  Pathways in cancer
ggo05202  Transcriptional misregulation in cancer
ggo05203  Viral carcinogenesis
ggo05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    109023024 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109023024 (HDAC2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109023024 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109023024 (HDAC2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    109023024 (HDAC2)
   05202 Transcriptional misregulation in cancers
    109023024 (HDAC2)
   05203 Viral carcinogenesis
    109023024 (HDAC2)
   05220 Chronic myeloid leukemia
    109023024 (HDAC2)
  09163 Neurodegenerative diseases
   05016 Huntington disease
    109023024 (HDAC2)
  09164 Substance dependence
   05034 Alcoholism
    109023024 (HDAC2)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    109023024 (HDAC2)
   05165 Human papillomavirus infection
    109023024 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ggo03036]
    109023024 (HDAC2)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109023024 (HDAC2)
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     109023024 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     109023024 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109023024 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    109023024 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 109023024
NCBI-ProteinID: XP_004044607
UniProt: G3QRQ8
LinkDB All DBs
Position
6
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaaaaaaaaagtctgctactactacgacggtgatatt
ggaaattattattatggacagggtcatcccatgaagcctcatagaatccgcatgacccat
aacttgctgttaaattatggcttatacagaaaaatggaaatatataggccccataaagcc
actgccgaagaaatgacaaaatatcacagtgatgagtatatcaaatttctacggtcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaagat
tgtccagtgtttgatggactctttgagttttgtcagctctcaactggcggttcagttgct
ggagctgtgaagttaaaccgacaacagactgatatggctgttaattgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttacgttaatgatattgtgcttgcc
atccttgaattactaaagtatcatcagagagtcttatatattgatatagatattcatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgacggtatcattccat
aaatatggggaatactttcctggcacaggagacttgagggatattggtgctggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgagtcatatgggcag
atatttaagcctattatctcaaaggtgatggagatgtatcaacctagtgctgtggtatta
cagtgtggtgcagactcattatctggtgatagactgggttgtttcaatctgacagtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaacttttaacttaccattgctgatgcttgga
ggaggtggctacacaatccgtaatgttgctcgatgttggacatatgagactgcagttgcc
cttgattgtgagattcccaatgagttgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttgcgcatgttacctcatgcacctggtgtc
cagatgcaagctattccagaagatgctgttcatgaagacagtggagatgaagatggagaa
gatccagacaagagaatttctattcgagcatcagacaagcggatagcttgcgatgaagaa
ttctcagattctgaggatgaaggagaaggaggtcgaagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaattgaagaagataagaaagaaacagaggacaaaaaaacagac
gttaaggaagaagataaatccaaggacaacagtggtgaaaaaacagataccaaaggaacc
aaatcagaacagctcagcaacccctga

DBGET integrated database retrieval system