KEGG   Gorilla gorilla gorilla (western lowland gorilla): 109024066
Entry
109024066         CDS       T02442                                 

Gene name
LHB
Definition
(RefSeq) lutropin subunit beta precursor
  KO
K08521  lutropin subunit beta
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04024  cAMP signaling pathway
ggo04080  Neuroactive ligand-receptor interaction
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04917  Prolactin signaling pathway
ggo04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    109024066 (LHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109024066 (LHB)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    109024066 (LHB)
   04912 GnRH signaling pathway
    109024066 (LHB)
   04913 Ovarian steroidogenesis
    109024066 (LHB)
   04917 Prolactin signaling pathway
    109024066 (LHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 109024066
NCBI-ProteinID: NP_001351941
LinkDB
Position
19
AA seq 141 aa
MEMLQGLLLLLLLSMGGAWASREPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT
MMRVLQGVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPMVSFPVALSCRCGPCHRSTSDC
GGPNDHPLTCDHPQLSGLLFL
NT seq 426 nt   +upstreamnt  +downstreamnt
atggagatgctccaggggctgctgctgttgctgctgctgagcatgggcggggcatgggca
tccagggagccgcttcggccacggtgccgccccatcaatgccaccctggctgtcgagaag
gagggctgccccgtgtgcatcaccgtcaacaccaccatctgtgccggctactgccccacc
atgatgcgcgtgctgcagggtgtcctgccgcccctgcctcaggtggtgtgcacctaccgt
gatgtgcgcttcgagtccatccggctccctggctgcccgcgtggcgtggaccccatggtc
tccttccctgtggctctcagctgtcgctgtggaccctgccaccgcagcacctctgactgt
gggggtcccaacgaccaccccttgacctgtgaccacccccaactctcaggcctcctcttc
ctctaa

DBGET integrated database retrieval system