KEGG   Gossypium hirsutum (upland cotton): 107888527Help
Entry
107888527         CDS       T04793                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00620  Pyruvate metabolism
ghi00710  Carbon fixation in photosynthetic organisms
ghi01100  Metabolic pathways
ghi01200  Carbon metabolism
Module
ghi_M00168  CAM (Crassulacean acid metabolism), dark
ghi_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
ghi_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
ghi_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107888527
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107888527
Enzymes [BR:ghi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     107888527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 107888527
NCBI-ProteinID: XP_016668157
UniProt: O23946
LinkDB All DBs
Position
13
AA seq 965 aa AA seqDB search
MAGRKVEKMASIDAQLRLLAPGKVSEDDKLVEYDAVLLDRFLDILQDLHGEDIRETVQEC
YELSAEYEGKHDPKILEELGKVLTSLDPGDSIVVTKSFSHMLNLGNLAEEVQIAYRRRIK
LKKGDFADESSATTESDIEETFKRLVGQLNKSPEEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRNPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRIRADELHRSSKKDAKHYIEFWKQIP
PNEPYRIILGDVRDKLYNTRERARSLLANGFSDIPEEAAFTNVEQFLEPLELCYRSLCAC
GDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLDIGSYREWPEERR
QEWLLSELRGKRPLFGPDLPKTEEVADVLDTFHVISELPSDSFGAYIISMATAPSDVLAV
ELLQRECHVKQPLRVVPLFEKLADLEAAPAAVARLFSIDWYRDRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELVKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPNPEWRALMDEMAVVATK
EYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHVIQKDIKNLHMLQEMHNQWPFFRVTMDLIEMVFAKGDPGIAALYDK
LLVSKELWPFGENLRANYEDTKRLVLQVAGHRDLLEGDPYLKQRLRLRDAYITTLNVCQA
YTLKRIRDPDYHVKVRPHLSREYMESSKAAAELVKLNPTSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtagaaaagtagagaagatggcttcaatagatgcacaactaaggctattagca
cctgggaaagtctctgaggatgataagttggttgaatatgatgctgtgctactggatcgt
tttcttgatattcttcaggatttgcatggagaggatatcagagaaacggttcaagaatgc
tacgagctttctgcggagtacgaaggaaagcatgatcctaaaatattggaggagcttggc
aaggtacttacaagcttggatcctggggactcaattgttgttaccaaatcattttcccac
atgcttaacttgggaaacttggccgaggaggttcaaattgcatatagacgaaggattaag
ttgaagaaaggagattttgctgatgagagttcagcaacaactgaatcagatattgaagag
acgttcaagcgacttgtggggcagttgaacaagtcccctgaagaagtttttgatgctttg
aagaatcagactgtagatttagtcttaactgcacatcctacacagtctgttcgaagatct
ttacttcaaaaacacggaaggatacgtaattgtttgacacaattgtatgctaaagacatt
acacctgatgataagcaggaacttgatgaggcactacaaagggagattcaagctgctttt
cgcacagatgagatccgaaggaatcctcccaccccacaagatgagatgagagcaggaatg
agctacttccacgagacaatctggaaaggtgtaccaaaattcttgcgtcgtgttgacaca
gctttgaagaacatagggataaatgaacgtgttccatacaatgcccctcttattcaattc
tcttcatggatgggaggggatcgtgatggaaaccccagggtaactcctgaagttacaaga
gatgtctgcttattagctagaatgatggctgctaacttgtacttctcccaaatagaggat
cttatgtttgagttatcaatgtggcgttgcagcgatgaacttcgtattcgtgcagatgaa
ctccataggtcctccaaaaaggatgcaaagcattacatagaattttggaaacagattcct
ccaaatgagccatatcgcattattcttggtgatgtgagggacaagctgtataatacacgt
gaacgtgctcgtagcctgttggccaatggattttctgacattcctgaagaagcagcattt
accaatgtggagcagtttctggagcctcttgaactctgctatagatcactctgtgcttgt
ggtgatcggccaatagctgatggaagccttcttgatttcttacggcaagtttctaccttt
gggctttcacttgtgaggcttgatatccgacaggaatctgatagacatactgatgtcctt
gatgctatcacaaagcacctggatattggatcttatcgagaatggcctgaggaacgccga
caggaatggctcttatctgaactcagaggcaagcgccctctattcggccctgatcttccc
aaaacagaagaagtcgctgatgtattggacacatttcatgtcatttctgaactgccttca
gacagctttggtgcctatataatctcaatggctacagccccatctgatgtgcttgctgtt
gagcttttacaacgtgaatgccatgtaaagcaaccattacgggtagttccattgtttgaa
aaactcgctgatcttgaagctgctcctgctgctgtggctcgtctcttctctatagattgg
tacagagaccggatcaatgggaaacaggaagtgatgataggttattcagattcaggaaag
gatgctggccgtctttctgcagcatggcagctatacaaggctcaggaggaacttgtaaag
gtggcaaagcagtatggtgttaagcttacaatgttccatggccgaggagggacagttgga
agaggagggggacccacgcatcttgctatattgtctcaaccacccgatacaattcatgga
tcacttcgtgtaacagttcaaggtgaagttattgaacaatcatttggagaggagcacttg
tgcttcaggacgcttcaacgttttactgctgctacacttgagcatggaatgcatccccct
gtctcaccaaatccagaatggcgtgcactcatggatgaaatggcagtagttgcaacaaag
gaataccgttctgtagtcttccaggaacctcgctttgttgaatacttccgcctagcaaca
ccagaattggagtatggtcggatgaatattggaagccgtccatcaaaaaggaaaccaagt
ggaggcattgaatcactccgtgcaatcccatggatctttgcatggactcaaacaagattt
catttacctgtgtggcttggctttggggctgcatttaagcacgtcattcagaaggatata
aagaatctccacatgctccaggagatgcacaaccaatggcctttctttagggtcacaatg
gacttaattgaaatggtatttgccaagggagaccctggaatcgctgccttatatgacaag
ctgctagtgtcaaaggaactctggccctttggagagaacttgagagctaactatgaagac
actaaacgacttgttctccaggttgctggacacagagatcttcttgaaggtgacccttac
ctgaagcagaggctccgacttcgtgatgcttacatcacaacccttaatgtgtgccaagcg
tacactttgaaaaggatccgtgaccctgattatcatgtcaaggtcaggcctcacttatcc
agggaatacatggaatcaagcaaggcggcagctgagcttgtgaaacttaaccctacaagc
gagtatgctcctggtctggaagacacccttattttgaccatgaagggtattgctgctgga
atgcaaaacactggttaa

DBGET integrated database retrieval system