KEGG   Gossypium hirsutum (upland cotton): 107893157Help
Entry
107893157         CDS       T04793                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107893157
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107893157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 107893157
NCBI-ProteinID: XP_016673572
UniProt: Q3SAX1
LinkDB All DBs
Position
15
AA seq 152 aa AA seqDB search
MVKAVAVLGSNEGVSGTVFFSQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGCASFSITDKQIPLTGPNSIIGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggccgttgccgtccttggcagcaatgaaggtgttagcggaactgttttcttc
tcccaagaaggagatggtccaactaccgtgactgggaacctttctggtcttaagccggga
ctccatggcttccatgttcatgcccttggggacacaactaacgggtgcatgtcaactgga
ccccattttaatcctgctggcaaagagcatggtgctccagaagatgagaaccgccatgct
ggtgatctagggaatgtcactgttggtgatgatggctgtgcaagcttctccatcaccgac
aaacagattcctctcacaggcccaaactccattatcggaagagctgtagttgtccatgca
gatcccgatgaccttggcaagggcggccatgagctcagcaaaagcacaggaaatgctggc
ggcagagtagcttgcggtattattggtctgcaaggctaa

DBGET integrated database retrieval system