KEGG   Gossypium hirsutum (upland cotton): 107897747Help
Entry
107897747         CDS       T04793                                 

Definition
(RefSeq) 3-ketoacyl-CoA thiolase 2, peroxisomal-like
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00071  Fatty acid degradation
ghi00280  Valine, leucine and isoleucine degradation
ghi00592  alpha-Linolenic acid metabolism
ghi01040  Biosynthesis of unsaturated fatty acids
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01212  Fatty acid metabolism
ghi04146  Peroxisome
Module
ghi_M00087  beta-Oxidation
ghi_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107897747
   00592 alpha-Linolenic acid metabolism
    107897747
   01040 Biosynthesis of unsaturated fatty acids
    107897747
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107897747
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107897747
Enzymes [BR:ghi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     107897747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 107897747
NCBI-ProteinID: XP_016678805
UniProt: A0A1U8IKY8
LinkDB All DBs
Position
16
AA seq 464 aa AA seqDB search
MEKAINRQQVLLQHLNPSASSFSSHQNNSALSASACLAGDSAAYLRTNVFGDDVVIVAAY
RTALCKSKRGGFKDTYPDDLLAPVLTAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRM
AAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTNPMAWEGS
VNPRVKQMEQAQNCLLPMGVTSENVAYRFGVTRQEQDQAAVESHRKAAAATASGKFKDEI
VPVATKIVDPKTGDEKPVTISVDDGIRANTSVSDLGKLKPVFKKNGTTTAGNSSQVSDGA
GAVLLMKRSVAMCKGLPILGVFRTFCAVGVDPAIMGVGPAVAIPAAVKSAGLELDDVDLF
EINEAFASQFVYCQKKLELDPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR
FGVVSMCIGTGMGAAAVFERGDCVDELCNARKVETHNLLSKDAR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagcgatcaaccgacagcaagttttgcttcaacaccttaatccttcagcttct
tctttttcgtcgcaccaaaacaactctgccctctctgcatcggcttgtttagctggagat
agcgctgcttatctaagaactaatgtatttggagatgatgtggtgatagtagcagcatat
aggaccgcgctttgcaaatccaagcgagggggtttcaaggatacttatcctgatgattta
cttgcacctgttttaacggcagtgatagagaaaacaaatttgaatcctagtgaagttggg
gatattgttgtgggaacggtattggcaccaggatctcaacgagctagcgaatgtcggatg
gctgcattctatgctggcttccctgaaactgtgcctgttagaactgtgaacaggcaatgc
tcatccgggcttcaggcagttgctgatgtagccgcagcgataaaagcagggttttatgaa
attggcattggagctgggttggaatctatgactactaatccaatggcatgggaaggttca
gttaacccaagggtgaagcaaatggagcaagctcagaattgtctccttcctatgggtgtt
acgtcagagaacgttgcttatcgttttggtgtgacgaggcaggagcaggatcaggctgca
gttgaatctcacaggaaagcagctgctgctacagcttctggtaaattcaaagatgaaata
gtccctgtggccaccaagattgttgatccaaagactggtgatgagaaacctgtcacaatc
tctgttgatgatgggatccgagctaacacatcagtgtcagatctgggaaaattgaagcct
gtattcaagaaaaatgggaccactactgctggaaattctagtcaagtgagtgatggtgct
ggagctgttctgcttatgaaaagaagtgttgcgatgtgcaaaggactaccaattcttggt
gttttcaggactttttgtgctgttggtgtggatcctgctatcatgggtgttggcccagct
gtggcaattccagcagcagttaaatctgctggtctagaacttgatgatgttgatcttttt
gagataaatgaggcatttgcatcccagttcgtatattgtcaaaagaagttggagctcgat
ccacaaaagattaatgtaaatggaggcgcaatggcaattggacatccattgggcgcaaca
ggtgctcgttgtgttgctacgcttctgcatgaaatgaagcgtcgtggcaaagactgccga
ttcggagtggtttcgatgtgcataggcacaggaatgggggcggcagcggtcttcgaaagg
ggtgattgtgttgatgagctgtgcaatgcccgaaaagttgaaactcacaatctcttatct
aaggatgcccgatag

DBGET integrated database retrieval system