KEGG   Gossypium hirsutum (upland cotton): 107898485Help
Entry
107898485         CDS       T04793                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00061  Fatty acid biosynthesis
ghi00780  Biotin metabolism
ghi01100  Metabolic pathways
ghi01212  Fatty acid metabolism
Module
ghi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107898485
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    107898485
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    107898485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ghi01004]
    107898485
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     107898485
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     107898485
Lipid biosynthesis proteins [BR:ghi01004]
 Fatty acid synthase
  Component type
   107898485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 107898485
NCBI-ProteinID: XP_016679435
UniProt: A0A1U8IMR7
LinkDB All DBs
Position
17
AA seq 391 aa AA seqDB search
MGTAAAPDPYMTNIKPCISSSRKIVVSTMVNIIAQHKEASWSGLASASHISSRQPFLHRI
TSKPVKFEKFVTRAMSEPSDNKPLSGLPIDLRGKRAFIAGVADDNGYGWAIAKSLAAAGA
EILVGTWVPALNIFESSLRRGKFDESRVLPDGSLMEITKVYPMDAVYDSPEDVPVDVKTN
KRYAGSSNWTVQELVECVKKDFGSIDILVHSLANGPEVSKPLLETSRNGYLAALSASSYS
YISLLKHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKHK
VRVNAISAGPLRSRAAKAIGFIDMMIDYSLANAPLQKELSSEEVGNAAAFLASPLSSAIT
GAVVYVDNGLNAMGVGVDSPIFENLDIPKDN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggaacggcagcagctcctgacccttacatgaccaacattaaaccttgtatttcttct
tctcgtaaaattgttgtctcgaccatggtgaacatcatcgctcagcataaagaggcatca
tggtcagggcttgcaagtgcctctcacatctcgtcaaggcagccgttcctccataggatc
acttcaaagcctgtcaagtttgaaaagtttgttacaagagccatgtctgaaccaagtgac
aacaagcctttgtctggacttcctattgatttgagaggtaaaagagcatttatagctggt
gttgctgatgacaatggatatggttgggcaatagcaaaatctcttgctgctgctggagct
gaaattcttgttggaacatgggtgcctgcactcaacatattcgagagcagtctaagacgt
gggaaatttgatgaatcacgcgtattgccagatgggtcattaatggagatcaccaaagtt
tatcccatggatgctgtttatgactctcccgaggatgtacctgtagatgtgaaaacaaac
aaacgttacgccgggtcttcaaactggacagttcaggagcttgttgaatgtgtgaaaaag
gattttggcagcattgacattcttgttcactcccttgcaaatggaccagaggtaagcaaa
cctcttttagagacatcaagaaatggatatcttgctgccctatctgcatcaagttactcc
tatatttctctactcaagcatttccttccaataatgaatccaggaggtgcttctatttct
ctaacatacattgcttctgaaagaataatcccaggatatggtggaggcatgagttcagca
aaggctgctttggagagtgatactcgtgtactggcttttgaagctggaagaaaacacaaa
gtcagagtcaacgcgatttctgcaggcccgttgaggagtagagctgcaaaggcaattgga
tttattgacatgatgatcgattactccctggctaacgcacccctacagaaagaactgtca
tcagaggaagtgggaaatgctgctgcctttctggcgtcgccgttgtcttcagctatcacg
ggggccgttgtgtatgtagacaatggcctaaatgcaatgggagtcggagttgacagtcca
atatttgagaaccttgacattccaaaagacaactga

DBGET integrated database retrieval system