KEGG   Gossypium hirsutum (upland cotton): 107901248Help
Entry
107901248         CDS       T04793                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00071  Fatty acid degradation
ghi00592  alpha-Linolenic acid metabolism
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01212  Fatty acid metabolism
Module
ghi_M00087  beta-Oxidation
ghi_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107901248
   00592 alpha-Linolenic acid metabolism
    107901248
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     107901248
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     107901248
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     107901248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 107901248
NCBI-ProteinID: XP_016682664
UniProt: A0A1U8J380
LinkDB All DBs
Position
18
AA seq 723 aa AA seqDB search
MAMAVTMEVGNDGVAVISISNPPLNIINAAMLAALKEKFGEATRRRDVKAIVLTGKGGRF
SGGFDINAFQNPSGDTSDRTIESIDLVLNTIEDCKKPVVAAIEGLALGGGLELAMGCHAR
IAAPKTQLGLPELTLGVIPGLGGTQSLPRLVGVSKAIEMMLFSKSIMSEEGKLLGLIDEI
ATSEELVRVSRLHALEISDGRKPWVHSLHRTDKIGSLSEAQQLLRTAREQAKRTAPNMPQ
HLACLDAVEEGLLLGGYKGLLKEAAVSKELVQSNTTKALTHLFFAQRATAKVPNITDVGL
KPNHVKKVGIIGGGIMGSGIATSLMLSNITVFLKEINSEYLLKGMKTVEANIQSLVARGK
VTQDKARKALSMLEGVSDYSDFKEMDMVIEAVIEDIPLKQEIFSELEKVCSSCCILATNT
SSIDLSVIGEKTKSQDRIIGAHFFSPAHIMPLLEIIGTEKTSPQVIRDLRTVGKIMKKVP
IVVLNCTGFAVNRSFFPYMQIPHLLVHLGVDLFRIDRAIRNFGFPLGPFQLQDLGGFRLG
KASGKEYENAFPDRTFRSPLTELLLKNGRNGKSNGKGFYVHEKGSKPKPDPSVLPIVDES
RKLMNIMPGGKPISVTDEEITEMVLFPTINEACRVLDEGVVARASDLDVASVLGMSFPSY
CGGIMFWADTVGSKHIYLSLKKWSERYGSYFKPSRYLEERAMKGMPLSVAVEAKSSLKSN
SKL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggcagtgacgatggaggttggaaacgatggtgtcgctgtcatttccatctct
aatcctcccttgaatatcatcaacgctgcaatgctagccgcactgaaggagaagttcggt
gaggctactaggagaagagatgtcaaagctattgttttgactggcaagggtggaaggttt
tcagggggttttgacatcaatgcttttcagaatcccagcggtgatacttcggatcgaaca
attgaatcaattgatcttgttctcaacactatagaggattgcaagaagccagttgttgcg
gctattgaaggattggctcttggtggtggcttagaattggcaatgggttgccatgctcgt
attgctgctccaaaaactcaattagggttgccagagttgacacttggggtgattcctgga
ctcggaggtactcaaagtcttccaaggcttgttggggtatcaaaggctattgaaatgatg
ctgttttctaagtcaataatgtctgaggaaggaaagttgcttggtcttattgatgaaata
gcaacctctgaagagttagttagagtgtctcgactacacgctttggaaatttctgacgga
cgtaaaccatgggtgcattctctccacaggacagacaaaatcggatccctgtctgaagca
cagcagttgttaagaactgctagagaacaagccaaaagaacagctccaaatatgcctcaa
caccttgcatgccttgatgctgttgaggagggccttctccttggaggatataaagggctt
ctaaaggaggcagcagtgtccaaagaattagttcagtcaaacactacgaaagctcttact
catctttttttcgcccaacgtgctacagcaaaggtgccaaacattactgacgtcggcctc
aaaccaaatcatgtcaagaaagttggtatcattggtggaggcataatgggctctggaatt
gctacatctcttatgcttagcaacataactgttttcctcaaggaaatcaactctgaatat
cttctaaaaggaatgaaaacagtagaagcaaatatccaaagcctggtagctagaggaaaa
gtgacacaggataaggcaagaaaagccctttctatgctcgaaggagtttctgactattca
gattttaaggaaatggatatggtcatagaggcggttattgaggacattccattgaagcaa
gaaatatttagcgagctcgagaaggtctgctcttcttgctgcattttggctacaaataca
tcctccattgaccttagtgtaattggagaaaagaccaaatcacaagatcgtatcattggg
gctcattttttcagtcctgctcatataatgcctctcctggagattataggaacagagaaa
acttctccgcaagttattcgtgatctccgaacagttgggaaaataatgaagaaagttcct
attgtggttcttaattgcactggctttgctgttaatcgatcattcttcccctatatgcaa
attccacatcttttggtccatcttggtgtggacttgttcagaattgacagagcgatcagg
aacttcggctttcctttaggtccattccagcttcaagacttgggtggatttagactaggc
aaggcttctgggaaagaatatgaaaatgcattccctgatcgaacattcaggtctccattg
actgaacttttgttgaaaaatggacgaaacggcaaaagcaacgggaaaggattttatgtt
catgaaaaaggaagcaagccaaaacctgatccatcagtgctacctattgttgatgaatct
agaaagcttatgaatattatgcctggtggaaagcctatatcagttacagatgaggaaatt
accgagatggtattgtttccaacgattaacgaggcatgtcgtgttttggatgagggtgtc
gttgctcgagcatcagaccttgatgttgcatctgtactcggaatgagcttcccatcctac
tgtggtggtatcatgttctgggcagatacagttgggtcgaagcatatctatttgagcctc
aagaaatggtcagaaaggtacggtagctactttaaaccatcgagatatttggaagaaaga
gccatgaaaggcatgccactgagtgttgcagtagaagcaaaatcatctctaaaatcgaac
tcaaagttgtag

DBGET integrated database retrieval system