KEGG   Gossypium hirsutum (upland cotton): 107909633Help
Entry
107909633         CDS       T04793                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00010  Glycolysis / Gluconeogenesis
ghi00053  Ascorbate and aldarate metabolism
ghi00071  Fatty acid degradation
ghi00280  Valine, leucine and isoleucine degradation
ghi00310  Lysine degradation
ghi00330  Arginine and proline metabolism
ghi00340  Histidine metabolism
ghi00380  Tryptophan metabolism
ghi00410  beta-Alanine metabolism
ghi00561  Glycerolipid metabolism
ghi00620  Pyruvate metabolism
ghi00903  Limonene and pinene degradation
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107909633
   00053 Ascorbate and aldarate metabolism
    107909633
   00620 Pyruvate metabolism
    107909633
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107909633
   00561 Glycerolipid metabolism
    107909633
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107909633
   00310 Lysine degradation
    107909633
   00330 Arginine and proline metabolism
    107909633
   00340 Histidine metabolism
    107909633
   00380 Tryptophan metabolism
    107909633
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107909633
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    107909633
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107909633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107909633
NCBI-ProteinID: XP_016692733
UniProt: A0A1U8JVD6
LinkDB All DBs
Position
20
AA seq 534 aa AA seqDB search
MAARRISSLLSCSLSYSSLLPKGRFCGVGRVVSGYSTSAGIENPINPSIKVHCTQLLING
NFVDSASGKTFPTYDPRTGDVIAHVAEGDAEDIDRAVCAARKAFDEGPWPKMTAYERSKV
LFRFADLLDKHIEELATLETWDNGKPYEQSAKIELPMISRIIRYYAGWADKIHGLTIPAD
GPHLVQTIHEPIGVAGQIIPWNFPLLMFAWKVGPALACGCTIVLKSAEQTPLSALYAAKL
LHEAGLPPGVLNVVSGFGPTAGAALASHMDVDKLAFTGSSETGKIVLELASKSNLKPVIL
ELGGKSPFIVCKDADVDKAVELAHFALFFNQGQCCSAGSRTYVHEDVHDEFIEKAKARAL
KRSVGDPFKAGVEQGPQIDSEQFEKILRYIRSGIESGAILITGGDRLGSKGFYIQPTVFT
NVKEDMLIAQDEIFGPVQSILKFRDMDEVIRRANSTRYGLAAGVFTNDLDTANTLSRALK
VGTVWINCYDVFDAAIPFGGYKMSGQGREKGVHCLSNYLQVKAIVAPLKNPAWI
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcggctaggaggatttcttcattgctttcctgctcattgtcttattcttccctcctt
cctaaagggaggttctgtggagtgggcagagtggtttctggttacagcacttctgctggt
attgagaacccgatcaatccttccatcaaagtgcactgcactcagcttttgattaatggg
aactttgttgattcagcatcaggtaaaacttttccaacatatgaccccaggacaggggat
gtgattgctcatgttgctgaaggtgatgcagaagatattgatcgagctgtttgtgctgct
cgcaaggcatttgatgaaggaccttggccaaagatgactgcttatgaaagatcaaaggta
ttgtttcgatttgctgatctccttgacaagcatatcgaggaacttgcaacgcttgagact
tgggataatggaaaaccgtatgaacagtctgctaagattgaactaccaatgatctcacga
ataattcggtactatgctggttgggcagacaagattcatggtcttacaattccagctgat
ggtccacaccttgtgcaaaccatacatgaaccaattggtgttgctggtcaaattattccg
tggaattttcctcttctcatgtttgcttggaaggttgggcctgccctagcatgtggctgt
acaatcgttcttaagtcagcagagcagacacctttgtcagctctttatgctgccaagcta
cttcatgaggctggacttcctccaggtgttctaaatgtggtttcaggttttggtccaact
gctggtgctgctcttgccagtcacatggatgtggataagcttgcattcactggatctagt
gaaactggaaaaattgtccttgagttagcttcaaaaagcaatcttaagcccgtaatattg
gagcttggaggaaagtctcctttcatcgtatgcaaggatgctgatgtggacaaagccgtt
gagctggctcactttgctttgttctttaatcaggggcaatgctgctctgccggctctcgt
acatatgtacacgaggatgtgcatgatgagtttatagagaaggcaaaggcacgtgcactg
aaacgtagcgttggtgatccattcaaggcaggagttgaacagggtccccagattgattcg
gaacaatttgaaaagatattgaggtacattagatcaggtatcgaaagtggagcaattctt
ataactggaggagatagattagggagcaagggcttctatattcagcccactgttttcacc
aacgtaaaggaagatatgttgattgcacaggatgagatatttggtccagttcaatcaatc
cttaaattcagggacatggatgaagttattcggagggcaaatagtacgagatacgggctg
gctgctggtgtatttacaaatgacttggacactgctaacaccttgagccgggcattgaaa
gttggaaccgtatggataaactgctatgatgtatttgacgcagccatcccatttggtggg
tacaagatgagtggacaaggaagagaaaagggtgttcactgtctcagcaattacttgcaa
gtcaaggctattgtggctcctttgaagaacccagcttggatatag

DBGET integrated database retrieval system