KEGG   Gossypium hirsutum (upland cotton): 107910364Help
Entry
107910364         CDS       T04793                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2-like
Organism
ghi  Gossypium hirsutum (upland cotton)
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 107910364
NCBI-ProteinID: XP_016693673
UniProt: A0A1U8JY44
LinkDB All DBs
Position
20
AA seq 2316 aa AA seqDB search
MGSCGNMTFVNEPSREVASAAAEQHLCSESMGKLVSEQRACVVIDSNGDYASEPGEDENS
ACKRSGDIDCKVGIKGEAQIVGSGTKGLMGGECCENSVCLKKNGGEIADASCSKALVGDM
CGDSVVCLENNQGDLMGDSGLKELMGNANDDTVVCLKDEGEIMNDSDSKELMDDRCRDCI
VYSIENQGEKEDGSFPLDLRSDTYRDSTVCSIGNQGENVDGAGSKELMVDMCGDAMVCLN
DNQGENPDCSGPEELMGYVDNTGYSNEIQCKNVDSGLNELKGDRISDHGVGLNENQDDVD
IHDSVTDVCLEKSGPSGEDGTNAAKGSLGLSQDKNTAALSSGIEISTNCEDQMKGDNENV
VGLMLKECMGNNQGRICLTGNMDVDDHLDSENDVSQDGEMPIELNTMSTSPRSSVKLDKQ
DDDERVNGSILQRILEYGEMKFEEKNDAVERKGTDVLNQILLSENFKGPFELIDATGEHK
SKDGMSTYCSSSEVAMEEKREVLTEVEANICNQMSSIQGSHLASTSIGIGDCRSDCPRQN
DLKDSNTIVGPSLDGESGASPVIESDTCGKISTSCCVETISNLQQTGDSVGSCDGHNQKD
DLSSSGLSLESFPKPVETKSTDDLCIELLASRRLFDTQKNAQTVGNDISDSSGDGVAEVS
EGRTDFLAYTKAEISSEIIINAKGKACNSNRDSFEQGANCLCDKSTSLSCQPVDVVENGL
SGRLDPQDLLAKDACAAISSSSSIDCSGQGENEGKDIVKADCVLETKNYPTTSSSSRKGR
QKGKSSRKTPAKRGARNCSSTKLRHPHESMEFLFKATRRKRSCSSKPARSSIWGLFSNIA
KFIEPCPDPSCNEVQNRKPSKARGGRGSGKRSKNRAGQNRKESSGLSNTLTSCLRLKIKV
GKEVAPSNVNTLVAEVVDPSVLIGTSFSNYGKETNLQYPTVANIVEDKVELGSEMRFQSK
EDQEMVKTCSDVFLTEVKLANKAVRCSENLERLSEDATDSSLISQSDAVAEASQEAIENK
CMDPGTSPDSEVINTIPDAQIGLIHQEESLDTVLNTSGPLASPRGAKTSKGSKRGKKDNH
RSPGTASTRKAKSSKSRRSREKTTGNGLVSIEALTSSSAANSSRENWIGVPKEATEMENS
MDIKDCCSPDVPDTKNTKHFSSSNSKCNQLSKSSRSQGASKGKSRVSDSVKSRKAKGSKR
RGDESKSVSKSKVKEKCSDEEIVARGGKSPVTGNQISDDNEHLNTGNSIESANMVNVDLV
PDGVMEQHTQPDNAWVRCDDCHKWRRIPVSLVKSIDEAYHWVCGDNVDKAFADCSIPQEK
SNADINAELGISDAEEDGCDGFNYKELEKGFETKRMTVSPPSHFWRIDSNQFLHRGRKTQ
TIDEIMVCQCKRPPDGKLGCGDECLNRMLNIECVQGTCPCGDLCSNQQFQNRKYAMMKWD
RFGKKGFGLRMLENISAGHFLIEYVGEVLDMQAYEARQKEYASRGQRHFYFMTLNGSEVI
DAYVKGNLGRFINHSCDPNCRTEKWMVNGEICIGLFALRDIKKGEEVTFDYNYVRVFGAA
AKKCHCGSPHCRGYIGGDPLSAEVIVHDDSDEESPEPMMLEDGETWTGFKDVLSRSGSSD
GAAMQSVESVITDGVLKPENMPEAEDSVNRSASATSELNTVETEEASPVTIASESVKPDG
TEEQKAMNKTSCSIQKLDASQDMSDNRLSSDVIDANKKSKSDAAEDKQVSAKSRPLMKTS
RSSSSIKKGKISSNSLSGNKVQTTSNKFQVSTVKPRKFSENSSTCRFEAVEEKLNELLDS
VGGITKRKDASKGYLKLLLLTATSGDSGGGEAIQSNRELSMILDALLKTKSGHVLTDIIN
KNGLQMLHNIMKKYRKDFKKIPILRKLLKVLEYLAGRGILTQEHINGGPYCAGRESFRES
ILSFTEHDDKQVHQIARNFRDKWIRKPVRKLGYRDKDEGRMEFFRGLDCNRVSASHNHWR
DQAIRSTEAINCIMQSVVGSTSSDTSTREGGSSLSVCLSQTNSTRIRKRKSRWDQPADTE
KIDSQSPKKLECSLLSALGQATPDQIEKMNSGDNKCQDSFSKGEAINIENGNQSFQQDAP
PGFSSPLNASLVSSTAPSTATGFPPPKVGQLKCPDVVIAHPQKRFISRLPVSYGIPLPIF
QQIRLPEGESLESWAIAPGIPFHPFPPLPPCPPDKKDTKPVSAALSTGINADSKEGQQES
RRPSTSCPDESVASTAGGNHPDSDIPGTDIQQTLKRTRESSYDLGRKYFRQQKRKGPQWD
KSESLGNNHTGEICCIDVGNINNEPRNSYYSDDINQ
NT seq 6951 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgtgtgggaatatgacttttgttaacgaaccttcgcgtgaagttgcttctgct
gctgccgagcaacatttgtgctctgagtcaatggggaaacttgtctctgagcaacgggct
tgcgttgtgattgattctaatggggactatgctagtgaaccgggtgaagatgaaaacagt
gcttgcaaaaggtctggggatattgattgcaaagttggaataaagggtgaggcccaaatt
gttggttctggtacgaagggcttgatgggtggtgaatgttgtgaaaactcagtttgtttg
aagaaaaatgggggtgaaattgctgatgcttcttgttcaaaagcattggtgggtgatatg
tgcggtgatagtgtggtttgtttggaaaataatcagggtgaccttatgggtgattctggc
ttgaaggaattgatgggcaatgcgaatgatgatactgtggtttgtttgaaagatgagggt
gaaattatgaatgattctgattcaaaggaattgatggatgataggtgcagggattgtata
gtttactcaatcgaaaatcaaggtgaaaaagaggatggttcttttccacttgacttgagg
agtgatacatatcgtgatagtacagtttgctccattggaaatcagggtgagaatgtagat
ggtgctggctcgaaggaattgatggttgatatgtgtggtgatgctatggtttgtttaaat
gataatcaaggtgaaaatccagattgctctgggccagaggaattgatgggttatgttgat
aatacaggttattcaaatgaaattcagtgtaaaaatgtagattctggtttgaatgaactg
aagggtgataggatcagtgatcatggggttggtttgaatgaaaatcaggatgatgttgac
attcatgattcagtaactgatgtgtgcttggaaaaaagtggaccttctggagaggatggt
acaaatgctgctaaaggatcactaggcttgtctcaggacaaaaacactgctgctttgagc
agtggcatagagatttctactaactgtgaagatcagatgaagggtgacaatgaaaatgtg
gttggtttgatgttaaaagaatgtatgggcaataaccaaggtaggatttgtttgactggg
aatatggatgtagatgatcatctcgactcagaaaatgatgtttcacaggatggggaaatg
ccaatagaactgaacacaatgtctacttcacctagaagttccgttaaactggataagcag
gatgacgatgagagggtcaatggttccattcttcaaaggattttggaatatggggaaatg
aagtttgaagagaaaaatgatgcagtagagaggaaagggactgatgttctgaaccaaata
ttgctttcagagaactttaaagggccctttgagttaatagatgcaactggtgaacacaag
agtaaggatggtatgagtacctattgttcctcttcggaagtagctatggaagaaaaacga
gaggtattaactgaggttgaggctaatatttgcaaccaaatgtcatctattcagggtagt
cacttggcttcaacatcaataggcattggtgattgcaggagtgattgtccccgacaaaat
gacctgaaggatagtaacactatcgtgggtccttctctagatggggaaagtggtgcttca
cccgtgatagaatctgatacatgcggcaagatatctacttcatgttgtgttgagacaatt
tccaacttacaacaaacaggtgattcagtgggtagttgtgatgggcataaccagaaagat
gatctcagtagcagtggtctctcattggaaagttttcctaaacctgtggaaactaaaagt
actgatgatttatgcattgagttgctagcttcaaggagattatttgacacacagaagaat
gcacaaactgttggtaatgatattagtgattcatcaggagatggtgttgcagaggtttct
gaggggaggactgattttcttgcatatacaaaggctgagatttccagtgaaataataata
aatgccaaaggaaaggcctgcaactcgaacagggattcttttgagcaaggtgcaaactgt
ctttgtgataaatcaacttctttgtcatgtcagcctgttgatgttgttgaaaatggcttg
tctggtcggttggatccacaagatcttttggcaaaggatgcatgtgctgcaattagttct
agcagttcaattgactgttctggacaaggagaaaatgaagggaaggatatcgtcaaggct
gattgtgttttagaaactaaaaattatccaaccacatcttcctcttctcgaaagggcaga
cagaaaggtaaatcaagccgaaagactcctgccaaaaggggtgctagaaactgcagtagc
acaaagctgcgtcacccacacgaaagtatggaattccttttcaaagctacaagaaggaag
agaagctgttcatcaaaaccagctcgttcttccatttggggattgttcagtaacattgcc
aaatttattgagccatgccctgatccttcatgtaatgaagtgcagaatcgaaaaccttct
aaagctaggggtggacgaggaagtgggaaacgaagcaaaaaccgagctggtcaaaacaga
aaagaatcaagtgggctaagtaacactttaaccagttgcctgcgtctgaagattaaagtg
ggcaaggaagttgctccaagtaatgtgaatactttggttgcagaagtggttgatccatca
gttcttattggtacttcttttagtaattatgggaaggaaaccaatttacaatatcctaca
gtagcaaatattgttgaagataaagtagaactgggtagtgaaatgcggtttcagtccaag
gaggatcaagaaatggtgaaaacatgctctgatgtttttcttacagaagtaaaactagca
aataaggctgtcaggtgttctgaaaatcttgagaggttgtctgaagatgctacagatagt
tcccttataagtcagtctgatgcagttgctgaagcatctcaagaagcaatagagaacaag
tgtatggaccctggaacttcaccagattcagaagtaatcaatacaattcctgatgcacaa
attgggttaatacaccaagaagagtcgcttgatactgttttgaatacttctgggccttta
gcttctcctagaggtgctaagactagcaagggtagcaagaggggaaaaaaggataatcat
agatctcctggtacagccagcactaggaaagctaaatcatctaagagtcgccgaagcaga
gaaaaaacaacaggtaatggacttgtctccatcgaggctcttacttcatcctctgctgca
aattcttcaagagagaattggattggagtccccaaagaggcaacagaaatggaaaatagt
atggatattaaagattgttgcagtcctgatgttccagatacaaagaacactaagcatttc
tcttcctctaatagcaagtgcaatcaactttccaaaagttcaagatctcagggagcgagc
aagggaaagtccagagtctctgattctgtcaagagcaggaaagcaaaaggttctaagcgg
aggggagacgagtcgaagtcagtaagtaagagcaaagtaaaggagaaatgctctgatgag
gagattgtagccagaggaggaaagagcccagtaacaggaaatcagatttcagatgataat
gagcacttaaatactggaaacagtattgaatctgcaaacatggttaatgttgacttggta
ccagatggtgtcatggagcagcatacacagcctgataatgcttgggtgcgttgtgatgat
tgtcataaatggcggcgaataccagtttcacttgtaaagtcaattgatgaggcgtaccat
tgggtctgtggggacaacgtggataaagcatttgctgattgttcaatcccacaagagaag
tccaatgcagatattaatgctgagttggggatatctgatgctgaggaagatggttgtgat
ggtttcaattataaggaattggaaaagggatttgaaactaaacgtatgacagtgtcgcca
ccttcacatttttggcgtattgatagtaaccaatttttgcaccgtggccggaaaactcaa
accattgatgagataatggtttgccagtgcaaacgacctccggacggtaagcttggttgt
ggggatgaatgcctaaatcggatgttgaatattgaatgtgttcaaggcacttgtccttgc
ggggacctctgttcaaatcaacagttccagaatcgcaaatatgcgatgatgaagtgggac
agatttggtaagaaaggttttgggctgaggatgctagagaatatatctgctggtcatttc
cttattgaatacgttggagaggttcttgatatgcaagcttatgaggctcggcaaaaggag
tatgcttctaggggtcagaggcatttctatttcatgacattgaatggcagtgaggtaata
gatgcatatgtaaagggaaatctggggcgcttcattaaccatagctgtgatcccaattgt
cgtactgaaaagtggatggtgaatggtgaaatttgtattggactgtttgcattgagagat
ataaaaaagggtgaagaggttacatttgactacaactatgtgagggtatttggagctgct
gcaaaaaaatgtcactgtggttcacctcattgtcggggttatataggtggtgatccactt
agtgctgaagtcattgttcatgatgattcggatgaagaatctcctgaaccgatgatgctt
gaagatggtgaaacctggactggttttaaagatgttttatctagatcaggttcctctgat
ggtgcagcaatgcaatctgtggagagtgtaataactgatggtgtactgaagcctgagaat
atgccagaagctgaggactctgtgaaccgttctgcttctgccacatcagaattgaacaca
gttgaaactgaagaagcttcgcctgtgacaattgccagtgaatctgttaagccagatggt
accgaggaacagaaggctatgaacaaaacctcatgttccattcagaaattagatgcttct
caagatatgtcagataatagattatcttccgatgttattgatgctaataagaagtcaaag
tctgatgctgcagaagacaaacaggtttctgcaaaatcacgccccctgatgaagacttct
cgttcatccagttctattaagaaggggaagattagtagtaattctctgagtggaaataag
gttcagacgacatccaacaaatttcaagtgtcaactgtcaagcccagaaaattctcggaa
aattctagtacttgccgttttgaagcagtggaggagaaacttaatgagttgctggattct
gtggggggaataacaaaacgaaaggatgcttctaaaggctacttgaagcttctgcttctc
acagctacttccggtgatagtggtggtggtgaagcaattcaaagcaatcgagagctttca
atgattcttgatgcacttttaaaaacaaaatccggacatgtgctgaccgatataattaac
aagaatggtttgcagatgctacacaacataatgaagaaatacagaaaggactttaaaaag
atccctattcttcggaagcttctaaaggttttagagtatttggcaggcaggggaattctt
acacaggagcatattaatggaggtccttactgtgctggaagggagagctttagggaatcg
attctgtcattcacagagcatgatgacaaacaggtccatcaaatagcccgaaattttcga
gataagtggattcgaaaacctgttagaaagcttggctacagggacaaggatgagggcagg
atggagttttttaggggtttggactgtaacagggtttcagcatctcacaatcattggcgt
gaccaggccatacgatctactgaagcaattaattgcatcatgcaatctgtggttggatca
acttcatcagatacttctacccgagagggtggttcctcgttatcagtttgtctttcccaa
accaacagtaccagaattcgcaagcggaaaagccgctgggatcagccagcggatacagag
aaaattgattctcagtcaccaaagaaactcgaatgtagcttgttatctgctttaggtcaa
gcaacaccagatcagatagagaagatgaacagtggggataacaaatgccaagacagtttt
tccaaaggtgaagctattaacattgagaatggaaaccaaagctttcagcaggatgctcca
ccagggttctcatctcctctcaatgcatctttggtgtcgtctactgctccatcaactgct
acaggtttccctccacctaaagttggtcagttgaagtgccctgatgtggttattgctcat
ccacagaagagattcatttcacgtttgcctgtttcatacggaatcccactgcccattttc
cagcagatcagattaccagaaggtgaaagtctagaaagttgggcaatagcccctggcatt
cctttccacccgtttccgcctttacctccatgtccccccgataagaaagacactaaacca
gtttctgctgctctctccactggaattaatgccgactcaaaagaagggcaacaggagagc
cgtcgaccttccactagttgtcctgatgagagcgttgcaagcacagctggtggaaaccac
ccagattcagacattccaggtactgacatccaacagacattgaaaagaacgagagaatcc
tcatatgatttgggtaggaagtacttcagacaacagaaacgaaaaggaccgcaatgggat
aaatctgaaagcttgggaaacaaccatacaggtgagatatgctgcatagatgtaggaaat
ataaacaatgagccccggaattcatattactcggatgatataaaccagtag

DBGET integrated database retrieval system