KEGG   Gossypium hirsutum (upland cotton): 107914321Help
Entry
107914321         CDS       T04793                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF-like
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107914321
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ghi03036]
    107914321
Enzymes [BR:ghi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107914321
Chromosome and associated proteins [BR:ghi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107914321
   Polycomb group proteins
    PRC2-EZH2 complex
     107914321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 107914321
NCBI-ProteinID: XP_016698682
UniProt: A0A1U8K855
LinkDB All DBs
Position
22
AA seq 919 aa AA seqDB search
MTAKPSRSASADRSEPPKDSSMTQIEGKTLSVKEILSVIDSLKKQVAVDRSLSVKTRLEE
NKQKLVGITSHLYKLSKERRSSWIIDTDSASDLLTKRQKDALGMQNGIDASNGDKDGYSY
QEPSTAVLMGSSIPVKNAVRPIKLTEVKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYD
QNGGEALICSDSEEELLEEDEEKKYFVESEDFILRMTIKEVGLSDPVLESLAQCLSRSPA
DVKARYETLMKEDTGASKNRDTEEQNWNSFLDKDLEAALDSFDNLFCRRCLVFDCRLHGC
SQDLIFPADKQTPWNRTDDENAPCGLHCYRSVLKSERNDTVRSPMNPEDKSNSSFDGVAA
QISSSKKSAGPSTRRKAKSSQSESASSNAKNLSESSDSEIRPRHEDSSPIPQLSPSKNKI
AGKSGILKRNSKRVAERVLICMRKRQKKMEASESDSLVSGGVSPTDMRLRSNPRKENEDA
TSSSQKDVKSSNTGRSRRKDWPLKGVQGEIPYSETVNDLAQTSSNGCLRNEEFVDENLCK
QELSDDKSWKAIEKGLFDKGLEIFGRNSCLIARNLLNGLKTCWEVFLYMTCSDNKLACHA
ADGVLSLLEGCSKFDLNGAMGNNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSIRKRITER
KDQPCRQYNPCSCQTACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCP
CFAADRECDPDVCRNCWVSCGDGTGSLGVPPQRGDNYECRNMKLLLKQQQRVLLGRSDVS
GWGAFLKNNVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGD
KLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEA
SGSKKEDGAPSSGRAKKLA
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgaaaccttcgcgttctgcttcggcggatagatcggaacctccaaaggattcc
tcgatgactcagattgaaggaaaaaccctgtctgttaaggagattttatcagtaattgat
tcgttaaagaaacaagttgctgtagatcgatctctgtctgtaaagacaaggttggaagaa
aacaagcaaaaactagttggtataacaagccatctttataaattgtcaaaggaacggaga
agcagttggattattgacaccgatagtgcttctgatctattgacaaagcggcaaaaagat
gcacttggtatgcaaaatggcattgatgcaagtaatggggataaggatggttatagctat
caagaaccttctacagcagttcttatgggatctagtattccagttaagaatgctgttcgc
cctattaagcttactgaagtaaaaaagctgccaccttatacaacatggatatttctagac
agaaatcaaagaatgacagaggatcaatcagtggtgggtagaaggagaatatactatgat
caaaatggtggtgaggcacttatctgcagcgacagtgaggaggaactacttgaggaagat
gaagaaaagaaatattttgttgaatctgaagactttatcctccgaatgactatcaaggaa
gttggtttgtctgatccggtgctggaatcactagcacagtgtttgtctagaagtccagct
gatgtcaaggcaagatacgaaactcttatgaaggaggatactggggcctctaagaatagg
gatactgaagaacaaaattggaattcctttctcgataaggatctagaagcagctcttgat
tcttttgacaatttattttgtagacggtgccttgtctttgattgcagattacatggatgt
tctcaggacctaatatttcctgctgataaacaaactccatggaatcgtacagatgatgag
aatgcaccatgtggtctgcattgctatcgttcggtacttaagtcagaaagaaatgacaca
gttaggtctccaatgaatcccgaagacaagtcaaattcttcatttgatggtgttgcggca
caaatatcatctagtaagaaatctgctggtccatctaccaggaggaaggcaaagtcaagc
caaagtgaaagtgcttcatccaatgccaaaaatctttcagaaagtagtgactcggagata
agacccaggcatgaagactcctcacctattcctcagttatcaccttctaagaataaaatt
gctggaaaatctggcattctcaagagaaatagcaagcgagtagctgaacgagttttaatt
tgcatgcgcaagaggcagaagaagatggaagcttccgaatctgattctcttgtgagtgga
ggtgtttcacctacagatatgagactcaggtctaatccacgaaaagaaaatgaagatgct
acgtcttcttcgcaaaaggatgtgaaatcctcaaacacaggaaggtctaggaggaaagat
tggccattaaaaggagtgcaaggagaaataccctatagtgagactgttaatgatctggct
cagactagtagcaatggttgcctgagaaatgaagagtttgtggacgaaaatttatgtaaa
caagaactaagtgatgataaatcttggaaagctattgaaaaaggtctttttgataaaggt
ctggagatttttggtaggaacagctgtttgattgccagaaatcttttaaacggattgaag
acatgttgggaggttttcctatacatgacctgctctgacaataagctggcttgccatgca
gctgatggtgttttatctcttcttgaagggtgttccaaatttgaccttaatggagctatg
ggaaataatgaagtaagacggagatcaagattcttacgtagaagaggtagagtccgtcgt
ttgaaatatacctggaaatcagctgcatatcactctatcaggaaaaggattactgagagg
aaagatcagccatgccggcagtataatccgtgtagctgtcaaactgcttgcggaaagcaa
tgttcttgccttttaaatggaacatgctgtgaaaaatactgcggatgtcctaagagttgc
aagaatcgatttagaggttgtcattgtgctaaaagtcaatgccgaagtcgtcagtgtcca
tgctttgctgcagacagggaatgtgatccggatgtttgtagaaattgctgggtcagttgt
ggtgatggcaccggtagtcttggggttcctccacaaagaggtgacaattatgaatgcaga
aatatgaagcttcttctgaaacagcaacaaagggtcttgcttggaagatcagatgtttct
ggatggggagcttttttgaagaataatgttggcaagcatgaataccttggtgagtacact
ggagagctgatctcccacagggaagcagataagcgtggaaagatatatgaccgtgaaaat
tcatcatttctattcaatctgaatgatcagtttgttcttgatgcataccgaaaaggtgac
aaattgaagttcgccaaccattctcctgagcctaattgctatgccaaggtcattatggtt
gcaggggatcaccgtgtgggtatatttgccaaagaacgaatcaatgcaggagaggaacta
ttctatgactaccgttacgagccagacagagctcctgcctgggctagaaaacccgaggca
tctgggtccaaaaaagaggatggtgctccttcgagcggacgagctaagaaacttgcttaa

DBGET integrated database retrieval system