KEGG   Gossypium hirsutum (upland cotton): 107918099Help
Entry
107918099         CDS       T04793                                 

Definition
(RefSeq) anthranilate synthase beta subunit 2, chloroplastic-like
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01230  Biosynthesis of amino acids
Module
ghi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    107918099
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    107918099
Enzymes [BR:ghi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     107918099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-GeneID: 107918099
NCBI-ProteinID: XP_016703097
UniProt: A0A1U8KKW0
LinkDB All DBs
Position
23
AA seq 280 aa AA seqDB search
MAANIITQSSLLQPKPALSAKTLQIPSLHRLSGLPPPSRVGFFLEKKTGIVGKAPLKSAV
SDSTSSVLENKKNSKNPIVVIDNYDSFTYNLCQYIGELGCYFEVFRNDELTVEDLKMKNP
RGVLISPGPGTPQDSGISLQTVLELGPTVPLFGVCMGLQCIGEAFGGKIVRSPYGVMHGK
SSPVYYDEKGEDGLLSGLSNPFNAGRYHSLVIEKDSFPEEALEVTAWTEDGLIMAARHKV
YKHLQGVQFHPESIITSEGKTIVRNFIKLIERKEVAGSKN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaatattataacccaatcatctctgcttcagccaaaacctgctctttctgct
aaaacccttcaaatcccatctctgcatcgcttatccggcctccctcctccatcaagggtt
ggcttttttctggaaaagaaaacggggattgttggaaaagctccattaaaatcggctgta
tcggactcaacctcgtcagttttggagaacaagaaaaacagcaagaatcccattgtcgtc
attgacaattacgacagtttcacttacaatctttgccagtatattggagagcttggatgt
tacttcgaggtttttcgaaatgacgaattaactgtagaagacttaaaaatgaaaaaccct
aggggagtgcttatctctcctggtccaggaacaccccaagattccggaatatcactgcag
actgttttggaacttggacctactgtacctttgtttggtgtttgtatgggtttgcagtgc
attggtgaggcttttggaggaaagatagtgcgttctccctatggtgttatgcatggcaaa
agttcccctgtatattatgacgaaaagggggaagacggtttgttatctggattgtcaaac
cctttcaatgctggcagatatcatagcctcgtgattgaaaaggacagtttccctgaggaa
gcacttgaggttactgcttggacagaagatggactgataatggctgctaggcacaaagtt
tataagcatctgcagggtgttcaattccatccagagagcatcataacctctgaaggaaaa
acaattgttcggaatttcatcaaactaatcgagagaaaggaggtggcaggatccaagaat
tag

DBGET integrated database retrieval system